Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2204225..2204866 | Replicon | chromosome |
| Accession | NZ_LT599047 | ||
| Organism | Brucella sp. 10RB9215 isolate BR10RB9215WGS1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | BR10RB9215_RS11355 | Protein ID | WP_138144650.1 |
| Coordinates | 2204684..2204866 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | BR10RB9215_RS11350 | Protein ID | WP_138144649.1 |
| Coordinates | 2204225..2204623 (-) | Length | 133 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BR10RB9215_RS11310 | 2200237..2200461 | + | 225 | WP_138144641.1 | hypothetical protein | - |
| BR10RB9215_RS11315 | 2200667..2200882 | - | 216 | WP_138144642.1 | hypothetical protein | - |
| BR10RB9215_RS11320 | 2201045..2201371 | - | 327 | WP_138144643.1 | hypothetical protein | - |
| BR10RB9215_RS11325 | 2201368..2202555 | - | 1188 | WP_172613313.1 | DUF3380 domain-containing protein | - |
| BR10RB9215_RS11330 | 2202566..2203231 | - | 666 | WP_138144645.1 | hypothetical protein | - |
| BR10RB9215_RS11335 | 2203450..2203635 | + | 186 | WP_138144646.1 | hypothetical protein | - |
| BR10RB9215_RS11340 | 2203632..2203853 | + | 222 | WP_138144647.1 | hypothetical protein | - |
| BR10RB9215_RS11345 | 2203935..2204120 | + | 186 | WP_138144648.1 | hypothetical protein | - |
| BR10RB9215_RS11350 | 2204225..2204623 | - | 399 | WP_138144649.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| BR10RB9215_RS11355 | 2204684..2204866 | - | 183 | WP_138144650.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| BR10RB9215_RS11360 | 2205020..2205469 | + | 450 | WP_138144651.1 | hypothetical protein | - |
| BR10RB9215_RS11365 | 2205992..2206327 | + | 336 | WP_138144652.1 | hypothetical protein | - |
| BR10RB9215_RS11370 | 2206312..2206509 | + | 198 | WP_138144653.1 | hypothetical protein | - |
| BR10RB9215_RS17875 | 2206560..2207696 | - | 1137 | WP_172613314.1 | hypothetical protein | - |
| BR10RB9215_RS18060 | 2208590..2209009 | - | 420 | Protein_2107 | site-specific DNA-methyltransferase | - |
| BR10RB9215_RS11385 | 2209015..2209269 | - | 255 | WP_138144655.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2200667..2214831 | 14164 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6822.94 Da Isoelectric Point: 11.0632
>T293258 WP_138144650.1 NZ_LT599047:c2204866-2204684 [Brucella sp. 10RB9215]
MERDSKKIVKRLKSEGFELISVRGSHHKFRKGDKTVIVPHPKKDLPQGTARSIAEQAGWI
MERDSKKIVKRLKSEGFELISVRGSHHKFRKGDKTVIVPHPKKDLPQGTARSIAEQAGWI
Download Length: 183 bp
Antitoxin
Download Length: 133 a.a. Molecular weight: 14199.96 Da Isoelectric Point: 4.4617
>AT293258 WP_138144649.1 NZ_LT599047:c2204623-2204225 [Brucella sp. 10RB9215]
MKHYFALVHKDDDSAYGVQFPDIPGVFSAADEINDIIKEAVEALQLYAEDAELPAASSHAEIIVRDDVKAELAKGAFLIS
VPYIEDDSAVVRANISFERGILKAIDATAKARGLSRSGFLAQAARHEIEAGA
MKHYFALVHKDDDSAYGVQFPDIPGVFSAADEINDIIKEAVEALQLYAEDAELPAASSHAEIIVRDDVKAELAKGAFLIS
VPYIEDDSAVVRANISFERGILKAIDATAKARGLSRSGFLAQAARHEIEAGA
Download Length: 399 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|