Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2192593..2193122 | Replicon | chromosome |
Accession | NZ_LT598688 | ||
Organism | Staphylococcus aureus isolate Sa_Newman_UoM |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | BN8422_RS11430 | Protein ID | WP_000621175.1 |
Coordinates | 2192593..2192955 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | BN8422_RS11435 | Protein ID | WP_000948331.1 |
Coordinates | 2192952..2193122 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN8422_RS11405 | 2189570..2190340 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
BN8422_RS11410 | 2190315..2190794 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
BN8422_RS11415 | 2190796..2191122 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
BN8422_RS11420 | 2191242..2192243 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
BN8422_RS11430 | 2192593..2192955 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
BN8422_RS11435 | 2192952..2193122 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
BN8422_RS11440 | 2193207..2194355 | - | 1149 | WP_001281145.1 | alanine racemase | - |
BN8422_RS11445 | 2194421..2194780 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
BN8422_RS11450 | 2194784..2195275 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
BN8422_RS11455 | 2195262..2196845 | - | 1584 | WP_001294631.1 | PH domain-containing protein | - |
BN8422_RS11460 | 2196838..2197317 | - | 480 | WP_001287088.1 | hypothetical protein | - |
BN8422_RS11465 | 2197526..2198086 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T293251 WP_000621175.1 NZ_LT598688:c2192955-2192593 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|