Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 48300..48950 | Replicon | plasmid 4 |
| Accession | NZ_LT598666 | ||
| Organism | Enterococcus faecium isolate Ef_aus00233 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | BN9748_RS16545 | Protein ID | WP_002332741.1 |
| Coordinates | 48300..48485 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A829EWE8 |
| Locus tag | BN9748_RS16550 | Protein ID | WP_002305052.1 |
| Coordinates | 48519..48950 (+) | Length | 144 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN9748_RS16500 | 43605..44504 | + | 900 | WP_014401509.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| BN9748_RS16505 | 44507..44992 | + | 486 | WP_014401510.1 | single-stranded DNA-binding protein | - |
| BN9748_RS16510 | 45358..45618 | + | 261 | WP_002296240.1 | hypothetical protein | - |
| BN9748_RS16515 | 46065..46271 | + | 207 | WP_002296239.1 | hypothetical protein | - |
| BN9748_RS16520 | 46271..46495 | + | 225 | WP_020944759.1 | hypothetical protein | - |
| BN9748_RS16525 | 46510..46947 | + | 438 | WP_020944760.1 | hypothetical protein | - |
| BN9748_RS16530 | 46940..47647 | + | 708 | WP_020944761.1 | hypothetical protein | - |
| BN9748_RS16540 | 48028..48207 | + | 180 | WP_002295613.1 | hypothetical protein | - |
| BN9748_RS16545 | 48300..48485 | + | 186 | WP_002332741.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| BN9748_RS16550 | 48519..48950 | + | 432 | WP_002305052.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| BN9748_RS16560 | 49887..51161 | + | 1275 | WP_002323715.1 | MFS transporter | - |
| BN9748_RS16565 | 51215..52642 | + | 1428 | WP_002332665.1 | sucrose-6-phosphate hydrolase | - |
| BN9748_RS16570 | 52655..53527 | + | 873 | WP_020944763.1 | ROK family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aac(6')-aph(2'') | - | 1..77977 | 77977 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6969.15 Da Isoelectric Point: 10.6196
>T293242 WP_002332741.1 NZ_LT598666:48300-48485 [Enterococcus faecium]
MPLTGKEMLKLLKKNGWVERRQEGSHHHLYKDGVRITVPVHANQDLGRGLEQKILKDAGLK
MPLTGKEMLKLLKKNGWVERRQEGSHHHLYKDGVRITVPVHANQDLGRGLEQKILKDAGLK
Download Length: 186 bp
Antitoxin
Download Length: 144 a.a. Molecular weight: 15811.92 Da Isoelectric Point: 4.1638
>AT293242 WP_002305052.1 NZ_LT598666:48519-48950 [Enterococcus faecium]
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
Download Length: 432 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|