Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 543722..544293 | Replicon | chromosome |
| Accession | NZ_LT598663 | ||
| Organism | Enterococcus faecium isolate Ef_aus00233 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q3Y2B8 |
| Locus tag | BN9748_RS02750 | Protein ID | WP_002286801.1 |
| Coordinates | 543952..544293 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | BN9748_RS02745 | Protein ID | WP_002323011.1 |
| Coordinates | 543722..543952 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN9748_RS02705 | 538965..540296 | + | 1332 | WP_002286818.1 | FAD-containing oxidoreductase | - |
| BN9748_RS02710 | 540318..540944 | + | 627 | WP_002333420.1 | cysteine hydrolase | - |
| BN9748_RS02715 | 541127..541708 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
| BN9748_RS02730 | 542317..542892 | + | 576 | WP_002293673.1 | SOS response-associated peptidase family protein | - |
| BN9748_RS02735 | 543097..543435 | - | 339 | WP_002286804.1 | hypothetical protein | - |
| BN9748_RS02745 | 543722..543952 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| BN9748_RS02750 | 543952..544293 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| BN9748_RS02755 | 545143..545328 | + | 186 | WP_002304207.1 | hypothetical protein | - |
| BN9748_RS02760 | 545833..546027 | + | 195 | WP_002295146.1 | hypothetical protein | - |
| BN9748_RS02765 | 546185..546467 | + | 283 | Protein_519 | transposase | - |
| BN9748_RS02770 | 546711..547541 | - | 831 | WP_002286789.1 | manganese catalase family protein | - |
| BN9748_RS02775 | 547749..549083 | + | 1335 | WP_002333419.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T293241 WP_002286801.1 NZ_LT598663:543952-544293 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FD66 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZZN9 |