Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 81134..81662 | Replicon | plasmid 2 |
| Accession | NZ_LT598658 | ||
| Organism | Legionella pneumophila strain Lpm7613 isolate Lpm7613 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0A8UYT5 |
| Locus tag | LPM7613_RS14865 | Protein ID | WP_011212544.1 |
| Coordinates | 81134..81421 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0A8UU85 |
| Locus tag | LPM7613_RS14870 | Protein ID | WP_011212545.1 |
| Coordinates | 81411..81662 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPM7613_RS14835 | 76441..77949 | + | 1509 | WP_011212538.1 | DUF3987 domain-containing protein | - |
| LPM7613_RS14840 | 78000..78575 | + | 576 | WP_011212539.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| LPM7613_RS14845 | 78584..78895 | + | 312 | WP_011212540.1 | hypothetical protein | - |
| LPM7613_RS14850 | 78951..79133 | + | 183 | WP_011212541.1 | hypothetical protein | - |
| LPM7613_RS14855 | 79227..80102 | - | 876 | WP_061468560.1 | alpha/beta hydrolase | - |
| LPM7613_RS14860 | 80160..80921 | - | 762 | WP_011212543.1 | MerR family transcriptional regulator | - |
| LPM7613_RS14865 | 81134..81421 | - | 288 | WP_011212544.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LPM7613_RS14870 | 81411..81662 | - | 252 | WP_011212545.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| LPM7613_RS14875 | 81911..82378 | - | 468 | WP_011212546.1 | hypothetical protein | - |
| LPM7613_RS14880 | 82997..83818 | - | 822 | WP_011212547.1 | DUF4111 domain-containing protein | - |
| LPM7613_RS14885 | 83802..84239 | - | 438 | WP_010655396.1 | DNA-binding protein | - |
| LPM7613_RS14890 | 84226..84804 | - | 579 | WP_010655397.1 | nucleotidyltransferase domain-containing protein | - |
| LPM7613_RS14895 | 85092..85973 | - | 882 | WP_021436862.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaOXA-29 | - | 1..129881 | 129881 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11302.35 Da Isoelectric Point: 10.4380
>T293239 WP_011212544.1 NZ_LT598658:c81421-81134 [Legionella pneumophila]
MIYELHFHPLALKEWKKLSKELQEQFKKLLKRRLENPHVISAKLSGHLKDCYKIKLHQAGYRLVYQVNDNKMILLVVAVG
KRNKNKVYESAEDRT
MIYELHFHPLALKEWKKLSKELQEQFKKLLKRRLENPHVISAKLSGHLKDCYKIKLHQAGYRLVYQVNDNKMILLVVAVG
KRNKNKVYESAEDRT
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A8UYT5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A8UU85 |