Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-CC2985 |
| Location | 53883..54417 | Replicon | plasmid 2 |
| Accession | NZ_LT596222 | ||
| Organism | Yersinia pseudotuberculosis isolate NZYP4713 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q663N8 |
| Locus tag | BN7064_RS22205 | Protein ID | WP_002213360.1 |
| Coordinates | 54118..54417 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | BN7064_RS22200 | Protein ID | WP_012414146.1 |
| Coordinates | 53883..54125 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN7064_RS22180 | 50314..51480 | + | 1167 | WP_002220902.1 | plasmid-partitioning protein SopA | - |
| BN7064_RS22185 | 51477..52442 | + | 966 | WP_002213354.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
| BN7064_RS23170 | 52770..53018 | + | 249 | WP_197684173.1 | hypothetical protein | - |
| BN7064_RS23065 | 53167..53340 | - | 174 | WP_002213357.1 | hypothetical protein | - |
| BN7064_RS22195 | 53425..53768 | + | 344 | Protein_66 | IS6 family transposase | - |
| BN7064_RS22200 | 53883..54125 | + | 243 | WP_012414146.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| BN7064_RS22205 | 54118..54417 | + | 300 | WP_002213360.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| BN7064_RS22210 | 54557..55216 | - | 660 | WP_002229754.1 | type III secretion system effector GTPase activator YopE | - |
| BN7064_RS22215 | 55410..55802 | + | 393 | WP_002213403.1 | type III secretion system chaperone SycE/YerA | - |
| BN7064_RS22220 | 55865..56314 | - | 450 | Protein_71 | transposase family protein | - |
| BN7064_RS22230 | 56417..57589 | + | 1173 | WP_011191364.1 | IS21 family transposase | - |
| BN7064_RS22235 | 57589..57987 | + | 399 | Protein_73 | ATP-binding protein | - |
| BN7064_RS22240 | 58365..58790 | + | 426 | WP_002213267.1 | type III secretion system chaperone SycH | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | yopO/ypkA / yopJ/yopP / yopH / lcrQ/yscM / yscL / yscK / ylpB/yscJ / lcrO/yscI / yopR/yscH/lcrP / yscG / yscF / yscE / yscD / yscC / yscB / virG/yscW / yscU / yscT / yscS / yscR / yscQ / yscP / yscO / yscN / lcrE/yopN / tyeA / sycN / yscX / yscY / yscV/lcrD / lcrR / lcrG / lcrV / sycD/lcrH / yopB / yopD / sycT / yopT / yopK/yopQ / yopE / sycE/yerA / sycH / yadA | 1..69815 | 69815 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11632.19 Da Isoelectric Point: 5.5114
>T293237 WP_002213360.1 NZ_LT596222:54118-54417 [Yersinia pseudotuberculosis]
VYKLSELADEDIYNIASYTIRHFGVTQAKLYHENLAKVFELLAKNPELGAECNWICSDIRRFQYKKHGIYYITLSNDILI
SRVLHQSIDIDVQDFPEHE
VYKLSELADEDIYNIASYTIRHFGVTQAKLYHENLAKVFELLAKNPELGAECNWICSDIRRFQYKKHGIYYITLSNDILI
SRVLHQSIDIDVQDFPEHE
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|