Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-CC2985
Location 53883..54417 Replicon plasmid 2
Accession NZ_LT596222
Organism Yersinia pseudotuberculosis isolate NZYP4713

Toxin (Protein)


Gene name parE Uniprot ID Q663N8
Locus tag BN7064_RS22205 Protein ID WP_002213360.1
Coordinates 54118..54417 (+) Length 100 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag BN7064_RS22200 Protein ID WP_012414146.1
Coordinates 53883..54125 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BN7064_RS22180 50314..51480 + 1167 WP_002220902.1 plasmid-partitioning protein SopA -
BN7064_RS22185 51477..52442 + 966 WP_002213354.1 ParB/RepB/Spo0J family plasmid partition protein -
BN7064_RS23170 52770..53018 + 249 WP_197684173.1 hypothetical protein -
BN7064_RS23065 53167..53340 - 174 WP_002213357.1 hypothetical protein -
BN7064_RS22195 53425..53768 + 344 Protein_66 IS6 family transposase -
BN7064_RS22200 53883..54125 + 243 WP_012414146.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
BN7064_RS22205 54118..54417 + 300 WP_002213360.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
BN7064_RS22210 54557..55216 - 660 WP_002229754.1 type III secretion system effector GTPase activator YopE -
BN7064_RS22215 55410..55802 + 393 WP_002213403.1 type III secretion system chaperone SycE/YerA -
BN7064_RS22220 55865..56314 - 450 Protein_71 transposase family protein -
BN7064_RS22230 56417..57589 + 1173 WP_011191364.1 IS21 family transposase -
BN7064_RS22235 57589..57987 + 399 Protein_73 ATP-binding protein -
BN7064_RS22240 58365..58790 + 426 WP_002213267.1 type III secretion system chaperone SycH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - yopO/ypkA / yopJ/yopP / yopH / lcrQ/yscM / yscL / yscK / ylpB/yscJ / lcrO/yscI / yopR/yscH/lcrP / yscG / yscF / yscE / yscD / yscC / yscB / virG/yscW / yscU / yscT / yscS / yscR / yscQ / yscP / yscO / yscN / lcrE/yopN / tyeA / sycN / yscX / yscY / yscV/lcrD / lcrR / lcrG / lcrV / sycD/lcrH / yopB / yopD / sycT / yopT / yopK/yopQ / yopE / sycE/yerA / sycH / yadA 1..69815 69815


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

Antitoxin ParD

(1-78)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11632.19 Da        Isoelectric Point: 5.5114

>T293237 WP_002213360.1 NZ_LT596222:54118-54417 [Yersinia pseudotuberculosis]
VYKLSELADEDIYNIASYTIRHFGVTQAKLYHENLAKVFELLAKNPELGAECNWICSDIRRFQYKKHGIYYITLSNDILI
SRVLHQSIDIDVQDFPEHE

Download         Length: 300 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8807.12 Da        Isoelectric Point: 6.8783

>AT293237 WP_012414146.1 NZ_LT596222:53883-54125 [Yersinia pseudotuberculosis]
MAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLMEAREQRVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKGTSV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q663N8

Antitoxin

Source ID Structure

References