Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3454916..3455536 | Replicon | chromosome |
| Accession | NZ_LT596221 | ||
| Organism | Yersinia pseudotuberculosis isolate NZYP4713 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | Q66DR5 |
| Locus tag | BN7064_RS15720 | Protein ID | WP_002208622.1 |
| Coordinates | 3455333..3455536 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | Q66DR4 |
| Locus tag | BN7064_RS15715 | Protein ID | WP_002218472.1 |
| Coordinates | 3454916..3455284 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN7064_RS15700 | 3453120..3453380 | + | 261 | WP_002208617.1 | type B 50S ribosomal protein L31 | - |
| BN7064_RS15705 | 3453396..3453539 | + | 144 | WP_002208618.1 | type B 50S ribosomal protein L36 | - |
| BN7064_RS15710 | 3454404..3454757 | + | 354 | WP_057534133.1 | hypothetical protein | - |
| BN7064_RS15715 | 3454916..3455284 | + | 369 | WP_002218472.1 | Hha toxicity modulator TomB | Antitoxin |
| BN7064_RS15720 | 3455333..3455536 | + | 204 | WP_002208622.1 | expression modulating protein YmoA | Toxin |
| BN7064_RS15730 | 3456442..3456831 | + | 390 | WP_002208623.1 | MGMT family protein | - |
| BN7064_RS15735 | 3456967..3457488 | - | 522 | WP_012413513.1 | YbaY family lipoprotein | - |
| BN7064_RS15740 | 3457745..3458605 | + | 861 | WP_002208625.1 | acyl-CoA thioesterase II | - |
| BN7064_RS15745 | 3458867..3460156 | - | 1290 | WP_002228344.1 | ammonium transporter AmtB | - |
| BN7064_RS15750 | 3460196..3460534 | - | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8063.31 Da Isoelectric Point: 6.4573
>T293236 WP_002208622.1 NZ_LT596221:3455333-3455536 [Yersinia pseudotuberculosis]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14215.00 Da Isoelectric Point: 4.6121
>AT293236 WP_002218472.1 NZ_LT596221:3454916-3455284 [Yersinia pseudotuberculosis]
MDEYSPKRHDIAQLKFLCESLYDEGIATLGDSHHGWINDPTSAINLQLNDLIEHIASFVMSFKIKYPDGSQLSELVEEYL
DDTYTLFSSYGINDPELRRWQKTKEHLFRLFSGEYVCTLMKT
MDEYSPKRHDIAQLKFLCESLYDEGIATLGDSHHGWINDPTSAINLQLNDLIEHIASFVMSFKIKYPDGSQLSELVEEYL
DDTYTLFSSYGINDPELRRWQKTKEHLFRLFSGEYVCTLMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|