Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1017575..1018247 | Replicon | chromosome |
Accession | NZ_LT596221 | ||
Organism | Yersinia pseudotuberculosis isolate NZYP4713 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A0U1R236 |
Locus tag | BN7064_RS04505 | Protein ID | WP_012104676.1 |
Coordinates | 1017822..1018247 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | Q666S3 |
Locus tag | BN7064_RS04500 | Protein ID | WP_002209939.1 |
Coordinates | 1017575..1017841 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN7064_RS04480 | 1013398..1014501 | + | 1104 | WP_012413926.1 | hypothetical protein | - |
BN7064_RS04485 | 1014703..1015404 | + | 702 | WP_057534195.1 | hemolysin III family protein | - |
BN7064_RS04490 | 1015696..1016193 | + | 498 | WP_002209941.1 | DUF2165 family protein | - |
BN7064_RS04495 | 1016266..1017258 | - | 993 | WP_012413924.1 | tRNA-modifying protein YgfZ | - |
BN7064_RS04500 | 1017575..1017841 | + | 267 | WP_002209939.1 | FAD assembly factor SdhE | Antitoxin |
BN7064_RS04505 | 1017822..1018247 | + | 426 | WP_012104676.1 | protein YgfX | Toxin |
BN7064_RS04510 | 1018247..1018945 | + | 699 | WP_002209937.1 | two-component system response regulator CreB | - |
BN7064_RS04515 | 1018970..1020388 | + | 1419 | WP_002209936.1 | two-component system sensor histidine kinase CreC | - |
BN7064_RS04520 | 1020509..1021966 | + | 1458 | WP_032466588.1 | cell envelope integrity protein CreD | - |
BN7064_RS04525 | 1022051..1022569 | - | 519 | WP_002209934.1 | flavodoxin FldB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 16467.40 Da Isoelectric Point: 10.1176
>T293230 WP_012104676.1 NZ_LT596221:1017822-1018247 [Yersinia pseudotuberculosis]
VAQWRCNLRVSWHTQLFSLLAHGILVILTLVAPWPLGYTALWLVLLTLVVFECIRSQKRIKSCQGEIRLKPGNLVLWKRH
EWTVVKPPWITRYGVLLHLQQTGGHATRKRLWLSADSMSEDEWRQLCLLLRHSFESDDGTM
VAQWRCNLRVSWHTQLFSLLAHGILVILTLVAPWPLGYTALWLVLLTLVVFECIRSQKRIKSCQGEIRLKPGNLVLWKRH
EWTVVKPPWITRYGVLLHLQQTGGHATRKRLWLSADSMSEDEWRQLCLLLRHSFESDDGTM
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0U1R236 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E8XP12 |