Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 92052..92808 | Replicon | chromosome |
| Accession | NZ_LT596221 | ||
| Organism | Yersinia pseudotuberculosis isolate NZYP4713 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A3G5KDU1 |
| Locus tag | BN7064_RS00435 | Protein ID | WP_032467110.1 |
| Coordinates | 92440..92808 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | Q664A5 |
| Locus tag | BN7064_RS00430 | Protein ID | WP_011193303.1 |
| Coordinates | 92052..92387 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN7064_RS00395 | 87200..87979 | + | 780 | WP_001297096.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
| BN7064_RS00400 | 88045..88281 | - | 237 | Protein_73 | inovirus Gp2 family protein | - |
| BN7064_RS00405 | 88946..89239 | + | 294 | Protein_74 | ATP-binding protein | - |
| BN7064_RS00410 | 89293..89928 | + | 636 | WP_080693614.1 | hypothetical protein | - |
| BN7064_RS00415 | 90176..90730 | + | 555 | WP_011193306.1 | hypothetical protein | - |
| BN7064_RS00420 | 90758..91378 | + | 621 | WP_011193305.1 | hypothetical protein | - |
| BN7064_RS00425 | 91561..92040 | + | 480 | WP_011193304.1 | hypothetical protein | - |
| BN7064_RS00430 | 92052..92387 | + | 336 | WP_011193303.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| BN7064_RS00435 | 92440..92808 | + | 369 | WP_032467110.1 | TA system toxin CbtA family protein | Toxin |
| BN7064_RS00440 | 93035..93889 | + | 855 | WP_032467109.1 | DUF4942 domain-containing protein | - |
| BN7064_RS00445 | 94276..94548 | + | 273 | WP_011193300.1 | Arm DNA-binding domain-containing protein | - |
| BN7064_RS00450 | 94783..95190 | + | 408 | WP_011193299.1 | hypothetical protein | - |
| BN7064_RS00455 | 95213..95539 | + | 327 | WP_011193298.1 | hypothetical protein | - |
| BN7064_RS00460 | 95481..95981 | + | 501 | WP_002214364.1 | virulence RhuM family protein | - |
| BN7064_RS00465 | 95978..96736 | - | 759 | WP_011193297.1 | ABC transporter ATP-binding protein | - |
| BN7064_RS00470 | 96733..97740 | - | 1008 | WP_011193296.1 | iron chelate uptake ABC transporter family permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 88030..103297 | 15267 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13723.81 Da Isoelectric Point: 6.4530
>T293229 WP_032467110.1 NZ_LT596221:92440-92808 [Yersinia pseudotuberculosis]
MQILPVTPKRAAYACPSPVVVWQSMLTYLLEQHYGLALNDTEFSDDAVIHEYIDAGISLSDALNFTVEKFGLVRIDRRGF
SCQEQSPFITAIDILRARRATGLMTRLGYQTIISVIRGEKQT
MQILPVTPKRAAYACPSPVVVWQSMLTYLLEQHYGLALNDTEFSDDAVIHEYIDAGISLSDALNFTVEKFGLVRIDRRGF
SCQEQSPFITAIDILRARRATGLMTRLGYQTIISVIRGEKQT
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G5KDU1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q664A5 |