293229

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yfjZ-ypjF/CbtA-CbeA
Location 92052..92808 Replicon chromosome
Accession NZ_LT596221
Organism Yersinia pseudotuberculosis isolate NZYP4713

Toxin (Protein)


Gene name ypjF Uniprot ID A0A3G5KDU1
Locus tag BN7064_RS00435 Protein ID WP_032467110.1
Coordinates 92440..92808 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID Q664A5
Locus tag BN7064_RS00430 Protein ID WP_011193303.1
Coordinates 92052..92387 (+) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BN7064_RS00395 87200..87979 + 780 WP_001297096.1 IS21-like element IS100kyp family helper ATPase IstB -
BN7064_RS00400 88045..88281 - 237 Protein_73 inovirus Gp2 family protein -
BN7064_RS00405 88946..89239 + 294 Protein_74 ATP-binding protein -
BN7064_RS00410 89293..89928 + 636 WP_080693614.1 hypothetical protein -
BN7064_RS00415 90176..90730 + 555 WP_011193306.1 hypothetical protein -
BN7064_RS00420 90758..91378 + 621 WP_011193305.1 hypothetical protein -
BN7064_RS00425 91561..92040 + 480 WP_011193304.1 hypothetical protein -
BN7064_RS00430 92052..92387 + 336 WP_011193303.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
BN7064_RS00435 92440..92808 + 369 WP_032467110.1 TA system toxin CbtA family protein Toxin
BN7064_RS00440 93035..93889 + 855 WP_032467109.1 DUF4942 domain-containing protein -
BN7064_RS00445 94276..94548 + 273 WP_011193300.1 Arm DNA-binding domain-containing protein -
BN7064_RS00450 94783..95190 + 408 WP_011193299.1 hypothetical protein -
BN7064_RS00455 95213..95539 + 327 WP_011193298.1 hypothetical protein -
BN7064_RS00460 95481..95981 + 501 WP_002214364.1 virulence RhuM family protein -
BN7064_RS00465 95978..96736 - 759 WP_011193297.1 ABC transporter ATP-binding protein -
BN7064_RS00470 96733..97740 - 1008 WP_011193296.1 iron chelate uptake ABC transporter family permease subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 88030..103297 15267


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-111)

Antitoxin

Antitoxin CbeA

(7-106)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13723.81 Da        Isoelectric Point: 6.4530

>T293229 WP_032467110.1 NZ_LT596221:92440-92808 [Yersinia pseudotuberculosis]
MQILPVTPKRAAYACPSPVVVWQSMLTYLLEQHYGLALNDTEFSDDAVIHEYIDAGISLSDALNFTVEKFGLVRIDRRGF
SCQEQSPFITAIDILRARRATGLMTRLGYQTIISVIRGEKQT

Download         Length: 369 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12452.06 Da        Isoelectric Point: 6.0555

>AT293229 WP_011193303.1 NZ_LT596221:92052-92387 [Yersinia pseudotuberculosis]
MPSITTPAWGLKRNVTPQFGARLVQEGDRLHFLADRADINGTFSEVQVRDLDNAFPQFINYLELMLLSGELNPRHQHCVT
LYRNGLTCEADSLGSHGYVYLAIYPTPQSTA

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G5KDU1

Antitoxin

Source ID Structure
AlphaFold DB Q664A5

References