Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4053644..4054479 Replicon chromosome
Accession NZ_LT594504
Organism Escherichia coli isolate E. coli RL465

Toxin (Protein)


Gene name yeeV Uniprot ID A0A376WVB1
Locus tag RL465_RS19565 Protein ID WP_001094448.1
Coordinates 4054102..4054479 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag RL465_RS19560 Protein ID WP_074417293.1
Coordinates 4053644..4054012 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RL465_RS19530 4050480..4050935 + 456 WP_000581504.1 hypothetical protein -
RL465_RS19535 4051014..4051247 + 234 WP_001119729.1 DUF905 family protein -
RL465_RS19540 4051347..4052165 + 819 WP_074417292.1 DUF945 domain-containing protein -
RL465_RS19545 4052220..4052705 + 486 WP_032286264.1 antirestriction protein -
RL465_RS19550 4052721..4053197 + 477 WP_001186727.1 RadC family protein -
RL465_RS19555 4053260..4053481 + 222 WP_000692345.1 DUF987 domain-containing protein -
RL465_RS19560 4053644..4054012 + 369 WP_074417293.1 type IV toxin-antitoxin system toxin CbtA Antitoxin
RL465_RS19565 4054102..4054479 + 378 WP_001094448.1 TA system toxin CbtA family protein Toxin
RL465_RS19570 4054476..4054964 + 489 WP_000761714.1 hypothetical protein -
RL465_RS19575 4054976..4055173 + 198 WP_000839243.1 DUF957 domain-containing protein -
RL465_RS19580 4055258..4056100 + 843 WP_021532534.1 DUF4942 domain-containing protein -
RL465_RS19585 4056381..4056917 - 537 WP_000942786.1 GspM family type II secretion system protein YghD -
RL465_RS19590 4056919..4058097 - 1179 WP_000094970.1 type II secretion system protein GspL -
RL465_RS19595 4058094..4059071 - 978 WP_000633220.1 type II secretion system minor pseudopilin GspK -
RL465_RS19600 4059074..4059277 - 204 Protein_3828 type II secretion system protein GspJ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4030338..4054479 24141


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14221.22 Da        Isoelectric Point: 8.2919

>T293225 WP_001094448.1 NZ_LT594504:4054102-4054479 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13538.40 Da        Isoelectric Point: 5.9562

>AT293225 WP_074417293.1 NZ_LT594504:4053644-4054012 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A376WVB1

Antitoxin

Source ID Structure

References