Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3488358..3488983 | Replicon | chromosome |
Accession | NZ_LT594504 | ||
Organism | Escherichia coli isolate E. coli RL465 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | RL465_RS16850 | Protein ID | WP_000911330.1 |
Coordinates | 3488358..3488756 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | RL465_RS16855 | Protein ID | WP_000450524.1 |
Coordinates | 3488756..3488983 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RL465_RS16830 | 3484236..3484436 | + | 201 | WP_000383836.1 | YpfN family protein | - |
RL465_RS16835 | 3484546..3485244 | - | 699 | WP_000679823.1 | esterase | - |
RL465_RS16840 | 3485318..3487333 | - | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
RL465_RS16845 | 3487348..3488211 | - | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
RL465_RS16850 | 3488358..3488756 | - | 399 | WP_000911330.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
RL465_RS16855 | 3488756..3488983 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
RL465_RS16860 | 3489137..3489850 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
RL465_RS16865 | 3490063..3491097 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
RL465_RS16870 | 3491114..3491992 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
RL465_RS16875 | 3492138..3492710 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
RL465_RS16880 | 3492710..3493180 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T293221 WP_000911330.1 NZ_LT594504:c3488756-3488358 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|