Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 581928..582726 | Replicon | chromosome |
Accession | NZ_LT594504 | ||
Organism | Escherichia coli isolate E. coli RL465 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | RL465_RS02830 | Protein ID | WP_074417329.1 |
Coordinates | 581928..582305 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1L4NTN5 |
Locus tag | RL465_RS02835 | Protein ID | WP_001605875.1 |
Coordinates | 582352..582726 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RL465_RS02810 | 578020..579558 | - | 1539 | WP_001187182.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
RL465_RS02815 | 580307..581149 | - | 843 | WP_074417327.1 | DUF4942 domain-containing protein | - |
RL465_RS02820 | 581234..581431 | - | 198 | WP_074417334.1 | DUF957 domain-containing protein | - |
RL465_RS02825 | 581443..581931 | - | 489 | WP_074417328.1 | hypothetical protein | - |
RL465_RS02830 | 581928..582305 | - | 378 | WP_074417329.1 | TA system toxin CbtA family protein | Toxin |
RL465_RS02835 | 582352..582726 | - | 375 | WP_001605875.1 | type IV toxin-antitoxin system toxin CbtA | Antitoxin |
RL465_RS02840 | 582800..583021 | - | 222 | WP_074417330.1 | DUF987 domain-containing protein | - |
RL465_RS02845 | 583090..583566 | - | 477 | WP_001186725.1 | RadC family protein | - |
RL465_RS02850 | 583582..584067 | - | 486 | WP_074417331.1 | antirestriction protein | - |
RL465_RS02855 | 584158..584976 | - | 819 | WP_074417332.1 | DUF945 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 570531..599673 | 29142 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14206.19 Da Isoelectric Point: 8.2905
>T293213 WP_074417329.1 NZ_LT594504:c582305-581928 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13594.42 Da Isoelectric Point: 5.4554
>AT293213 WP_001605875.1 NZ_LT594504:c582726-582352 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLACEADTLGSCGYVYMAVYPTLAPATTS
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLACEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|