Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1600184..1600869 Replicon chromosome
Accession NZ_LT592159
Organism Neisseria gonorrhoeae strain WHO_U

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag C7S04_RS09390 Protein ID WP_003689143.1
Coordinates 1600687..1600869 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag C7S04_RS09385 Protein ID WP_003691454.1
Coordinates 1600184..1600585 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C7S04_RS09330 1595268..1595483 - 216 WP_003691538.1 hypothetical protein -
C7S04_RS09335 1595535..1596026 - 492 WP_003691537.1 siphovirus Gp157 family protein -
C7S04_RS09340 1596023..1596205 - 183 WP_003691535.1 hypothetical protein -
C7S04_RS09345 1596345..1597031 - 687 WP_010359969.1 hypothetical protein -
C7S04_RS09350 1597100..1597261 - 162 WP_003691530.1 hypothetical protein -
C7S04_RS09355 1597258..1597533 - 276 WP_047917337.1 hypothetical protein -
C7S04_RS09360 1597649..1597981 - 333 WP_003705604.1 hypothetical protein -
C7S04_RS09365 1598122..1598397 - 276 WP_050172639.1 hypothetical protein -
C7S04_RS09370 1598394..1598870 - 477 WP_002255718.1 hypothetical protein -
C7S04_RS09375 1598903..1599103 - 201 WP_003687954.1 hypothetical protein -
C7S04_RS09380 1599303..1600085 + 783 WP_003689146.1 hypothetical protein -
C7S04_RS09385 1600184..1600585 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
C7S04_RS09390 1600687..1600869 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
C7S04_RS09395 1601039..1601857 - 819 WP_012503752.1 DUF3037 domain-containing protein -
C7S04_RS09400 1601854..1602552 - 699 WP_003689139.1 hypothetical protein -
C7S04_RS09405 1602791..1603489 - 699 WP_002212401.1 helix-turn-helix domain-containing protein -
C7S04_RS09410 1603529..1604182 - 654 WP_157149898.1 helix-turn-helix transcriptional regulator -
C7S04_RS09415 1604380..1604565 + 186 WP_048654326.1 helix-turn-helix domain-containing protein -
C7S04_RS13670 1604567..1604767 + 201 WP_012503750.1 hypothetical protein -
C7S04_RS09425 1604964..1605770 + 807 WP_050154472.1 replication protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1586758..1620299 33541


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T293206 WP_003689143.1 NZ_LT592159:c1600869-1600687 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT293206 WP_003691454.1 NZ_LT592159:c1600585-1600184 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References