Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 1020028..1020683 | Replicon | chromosome |
Accession | NZ_LT592159 | ||
Organism | Neisseria gonorrhoeae strain WHO_U |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | C7S04_RS05915 | Protein ID | WP_003691083.1 |
Coordinates | 1020028..1020447 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | C7S04_RS05920 | Protein ID | WP_003688410.1 |
Coordinates | 1020447..1020683 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C7S04_RS05895 | 1015304..1016845 | - | 1542 | WP_003697015.1 | multidrug efflux MFS transporter | - |
C7S04_RS05900 | 1016993..1017772 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
C7S04_RS05905 | 1017769..1018470 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
C7S04_RS05910 | 1018467..1019879 | + | 1413 | WP_106333340.1 | lactate utilization protein | - |
C7S04_RS05915 | 1020028..1020447 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
C7S04_RS05920 | 1020447..1020683 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
C7S04_RS05925 | 1020889..1021086 | - | 198 | WP_033910354.1 | IS3 family transposase | - |
C7S04_RS05930 | 1021131..1021709 | - | 579 | WP_003688041.1 | IS3 family transposase | - |
C7S04_RS05935 | 1021714..1022142 | - | 429 | WP_003701165.1 | helix-turn-helix domain-containing protein | - |
C7S04_RS05945 | 1022354..1022740 | + | 387 | Protein_1024 | IS110 family transposase | - |
C7S04_RS05950 | 1023123..1024013 | - | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
C7S04_RS05955 | 1024024..1025190 | - | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
C7S04_RS05960 | 1025262..1025549 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1022333..1022806 | 473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T293205 WP_003691083.1 NZ_LT592159:c1020447-1020028 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|