Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1538787..1539472 Replicon chromosome
Accession NZ_LT592157
Organism Neisseria gonorrhoeae strain WHO P

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag C7S06_RS09015 Protein ID WP_003689143.1
Coordinates 1539290..1539472 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag C7S06_RS09010 Protein ID WP_003691454.1
Coordinates 1538787..1539188 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C7S06_RS08955 1533831..1534046 - 216 WP_003691538.1 hypothetical protein -
C7S06_RS08960 1534098..1534589 - 492 WP_004464807.1 siphovirus Gp157 family protein -
C7S06_RS08965 1534586..1534768 - 183 WP_003691535.1 hypothetical protein -
C7S06_RS08970 1534909..1535595 - 687 WP_003693865.1 hypothetical protein -
C7S06_RS08975 1535664..1535825 - 162 WP_003691530.1 hypothetical protein -
C7S06_RS08980 1535822..1536097 - 276 WP_047923918.1 hypothetical protein -
C7S06_RS08985 1536251..1536583 - 333 WP_047923919.1 hypothetical protein -
C7S06_RS08990 1536725..1537000 - 276 WP_050171366.1 hypothetical protein -
C7S06_RS08995 1536997..1537473 - 477 WP_002255718.1 hypothetical protein -
C7S06_RS09000 1537506..1537706 - 201 WP_047917349.1 hypothetical protein -
C7S06_RS09005 1537906..1538688 + 783 WP_003689146.1 hypothetical protein -
C7S06_RS09010 1538787..1539188 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
C7S06_RS09015 1539290..1539472 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
C7S06_RS09020 1539642..1540460 - 819 WP_012503752.1 DUF3037 domain-containing protein -
C7S06_RS09025 1540457..1541155 - 699 WP_048654307.1 hypothetical protein -
C7S06_RS09035 1541394..1542092 - 699 WP_002212401.1 helix-turn-helix domain-containing protein -
C7S06_RS09040 1542132..1542785 - 654 WP_157149898.1 helix-turn-helix transcriptional regulator -
C7S06_RS09045 1542983..1543168 + 186 WP_048654326.1 helix-turn-helix domain-containing protein -
C7S06_RS13195 1543170..1543370 + 201 WP_012503750.1 hypothetical protein -
C7S06_RS09055 1543567..1544373 + 807 WP_050154472.1 replication protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1523603..1557255 33652


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T293204 WP_003689143.1 NZ_LT592157:c1539472-1539290 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT293204 WP_003691454.1 NZ_LT592157:c1539188-1538787 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References