Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1151299..1151984 Replicon chromosome
Accession NZ_LT592155
Organism Neisseria gonorrhoeae strain WHO_X

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag C7S01_RS06805 Protein ID WP_003689143.1
Coordinates 1151299..1151481 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag C7S01_RS06810 Protein ID WP_003691454.1
Coordinates 1151583..1151984 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C7S01_RS06770 1146314..1147204 - 891 WP_106158904.1 replication protein -
C7S01_RS13275 1147401..1147601 - 201 WP_012503750.1 hypothetical protein -
C7S01_RS06780 1147603..1147788 - 186 WP_048654326.1 helix-turn-helix domain-containing protein -
C7S01_RS06785 1147953..1148639 + 687 WP_012503751.1 helix-turn-helix transcriptional regulator -
C7S01_RS06790 1148679..1149377 + 699 WP_002212401.1 helix-turn-helix domain-containing protein -
C7S01_RS06795 1149616..1150314 + 699 WP_003689139.1 hypothetical protein -
C7S01_RS06800 1150311..1151129 + 819 WP_012503752.1 DUF3037 domain-containing protein -
C7S01_RS06805 1151299..1151481 + 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
C7S01_RS06810 1151583..1151984 + 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
C7S01_RS06815 1152083..1152865 - 783 WP_003689146.1 hypothetical protein -
C7S01_RS06820 1153065..1153265 + 201 WP_003704298.1 hypothetical protein -
C7S01_RS06825 1153298..1153774 + 477 WP_002255718.1 hypothetical protein -
C7S01_RS06830 1153771..1154058 + 288 WP_041421246.1 hypothetical protein -
C7S01_RS06835 1154199..1154531 + 333 WP_047919601.1 phage associated protein -
C7S01_RS06840 1154684..1154962 + 279 WP_003691529.1 hypothetical protein -
C7S01_RS06845 1154959..1155120 + 162 WP_003691530.1 hypothetical protein -
C7S01_RS06850 1155189..1155875 + 687 WP_042758540.1 hypothetical protein -
C7S01_RS06855 1156015..1156197 + 183 WP_003691535.1 hypothetical protein -
C7S01_RS06860 1156194..1156685 + 492 WP_003691537.1 siphovirus Gp157 family protein -
C7S01_RS06865 1156737..1156952 + 216 WP_003691538.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1103480..1170755 67275


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T293202 WP_003689143.1 NZ_LT592155:1151299-1151481 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT293202 WP_003691454.1 NZ_LT592155:1151583-1151984 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References