Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1207813..1208499 Replicon chromosome
Accession NZ_LT592153
Organism Neisseria gonorrhoeae strain WHO_Z

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag C7R99_RS07065 Protein ID WP_003689143.1
Coordinates 1207813..1207995 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag C7R99_RS07070 Protein ID WP_003691454.1
Coordinates 1208098..1208499 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C7R99_RS07025 1202865..1203644 - 780 WP_025455804.1 ATP-binding protein -
C7R99_RS07030 1203656..1204666 - 1011 WP_014580341.1 helix-turn-helix domain-containing protein -
C7R99_RS07035 1204663..1204890 - 228 WP_003691442.1 helix-turn-helix domain-containing protein -
C7R99_RS07040 1205064..1205252 + 189 WP_010951056.1 hypothetical protein -
C7R99_RS07045 1205229..1205384 - 156 WP_003689578.1 hypothetical protein -
C7R99_RS07050 1205473..1205658 - 186 WP_002238713.1 Cro/Cl family transcriptional regulator -
C7R99_RS07055 1205795..1206550 + 756 WP_003693472.1 LexA family transcriptional regulator -
C7R99_RS07060 1206825..1207643 + 819 WP_003693474.1 DUF3037 domain-containing protein -
C7R99_RS07065 1207813..1207995 + 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
C7R99_RS07070 1208098..1208499 + 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
C7R99_RS07075 1208596..1209378 - 783 WP_003689146.1 hypothetical protein -
C7R99_RS07080 1209567..1209762 + 196 Protein_1231 hypothetical protein -
C7R99_RS07085 1209795..1210271 + 477 WP_003691526.1 hypothetical protein -
C7R99_RS07090 1210268..1210543 + 276 WP_144858278.1 hypothetical protein -
C7R99_RS07095 1210684..1211016 + 333 WP_003691528.1 hypothetical protein -
C7R99_RS07100 1211169..1211447 + 279 WP_003691529.1 hypothetical protein -
C7R99_RS07105 1211444..1211605 + 162 WP_003691530.1 hypothetical protein -
C7R99_RS07110 1211674..1212360 + 687 WP_042758540.1 hypothetical protein -
C7R99_RS07115 1212500..1212682 + 183 WP_003691535.1 hypothetical protein -
C7R99_RS07120 1212679..1213170 + 492 WP_003691537.1 siphovirus Gp157 family protein -
C7R99_RS07125 1213222..1213437 + 216 WP_003691538.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1168506..1227237 58731


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T293200 WP_003689143.1 NZ_LT592153:1207813-1207995 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT293200 WP_003691454.1 NZ_LT592153:1208098-1208499 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References