Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 723360..724015 | Replicon | chromosome |
Accession | NZ_LT592153 | ||
Organism | Neisseria gonorrhoeae strain WHO_Z |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | C7R99_RS04415 | Protein ID | WP_003691083.1 |
Coordinates | 723596..724015 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | C7R99_RS04410 | Protein ID | WP_003688410.1 |
Coordinates | 723360..723596 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C7R99_RS04370 | 718494..718781 | + | 288 | WP_003688407.1 | hypothetical protein | - |
C7R99_RS04375 | 718853..720019 | + | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
C7R99_RS04380 | 720030..720920 | + | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
C7R99_RS04385 | 721303..721689 | - | 387 | Protein_745 | IS110 family transposase | - |
C7R99_RS04395 | 721901..722329 | + | 429 | WP_003701165.1 | helix-turn-helix domain-containing protein | - |
C7R99_RS04400 | 722334..722912 | + | 579 | WP_003688041.1 | IS3 family transposase | - |
C7R99_RS04405 | 722957..723154 | + | 198 | WP_033910354.1 | IS3 family transposase | - |
C7R99_RS04410 | 723360..723596 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
C7R99_RS04415 | 723596..724015 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
C7R99_RS04420 | 724164..725618 | - | 1455 | WP_003688412.1 | iron-sulfur cluster-binding protein | - |
C7R99_RS04425 | 725615..726316 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
C7R99_RS04430 | 726313..727092 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
C7R99_RS04435 | 727240..728781 | + | 1542 | WP_003701286.1 | multidrug efflux MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T293199 WP_003691083.1 NZ_LT592153:723596-724015 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|