Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 721243..721898 | Replicon | chromosome |
Accession | NZ_LT592150 | ||
Organism | Neisseria gonorrhoeae strain WHO_V |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | C7S08_RS04505 | Protein ID | WP_003691083.1 |
Coordinates | 721479..721898 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | C7S08_RS04500 | Protein ID | WP_003688410.1 |
Coordinates | 721243..721479 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C7S08_RS04455 | 716378..716665 | + | 288 | WP_003688407.1 | hypothetical protein | - |
C7S08_RS04460 | 716737..717903 | + | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
C7S08_RS04465 | 717914..718804 | + | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
C7S08_RS04475 | 719187..719573 | - | 387 | Protein_744 | IS110 family transposase | - |
C7S08_RS04485 | 719785..720213 | + | 429 | WP_003701165.1 | helix-turn-helix domain-containing protein | - |
C7S08_RS04490 | 720218..720796 | + | 579 | WP_003688041.1 | IS3 family transposase | - |
C7S08_RS04495 | 720841..721038 | + | 198 | WP_033910354.1 | IS3 family transposase | - |
C7S08_RS04500 | 721243..721479 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
C7S08_RS04505 | 721479..721898 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
C7S08_RS04510 | 722047..723501 | - | 1455 | WP_003701282.1 | iron-sulfur cluster-binding protein | - |
C7S08_RS04515 | 723498..724199 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
C7S08_RS04520 | 724196..724975 | - | 780 | WP_041421436.1 | (Fe-S)-binding protein | - |
C7S08_RS04525 | 725123..726664 | + | 1542 | WP_003697015.1 | multidrug efflux MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T293198 WP_003691083.1 NZ_LT592150:721479-721898 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|