Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1581806..1582491 Replicon chromosome
Accession NZ_LT592146
Organism Neisseria gonorrhoeae strain WHO O

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag WHOZ_RS09310 Protein ID WP_003689143.1
Coordinates 1582309..1582491 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag WHOZ_RS09305 Protein ID WP_003691454.1
Coordinates 1581806..1582207 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
WHOZ_RS09250 1576863..1577078 - 216 WP_003691538.1 hypothetical protein -
WHOZ_RS09255 1577130..1577621 - 492 WP_003696912.1 siphovirus Gp157 family protein -
WHOZ_RS09260 1577618..1577800 - 183 WP_003691535.1 hypothetical protein -
WHOZ_RS09265 1577940..1578626 - 687 WP_042758540.1 hypothetical protein -
WHOZ_RS09270 1578695..1578856 - 162 WP_003693867.1 hypothetical protein -
WHOZ_RS09275 1578853..1579128 - 276 WP_003694990.1 hypothetical protein -
WHOZ_RS09280 1579281..1579613 - 333 WP_003695500.1 hypothetical protein -
WHOZ_RS09285 1579754..1580029 - 276 WP_047925817.1 hypothetical protein -
WHOZ_RS09290 1580026..1580502 - 477 WP_002255718.1 hypothetical protein -
WHOZ_RS09295 1580535..1580735 - 201 WP_106350342.1 hypothetical protein -
WHOZ_RS09300 1580925..1581707 + 783 WP_003689146.1 hypothetical protein -
WHOZ_RS09305 1581806..1582207 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
WHOZ_RS09310 1582309..1582491 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
WHOZ_RS09315 1582661..1583479 - 819 WP_025455900.1 DUF3037 domain-containing protein -
WHOZ_RS09320 1583476..1584174 - 699 WP_003689139.1 hypothetical protein -
WHOZ_RS09325 1584413..1585123 - 711 WP_025455899.1 helix-turn-helix transcriptional regulator -
WHOZ_RS09330 1585239..1585427 + 189 WP_003689136.1 helix-turn-helix domain-containing protein -
WHOZ_RS09335 1585507..1585662 + 156 WP_003691446.1 hypothetical protein -
WHOZ_RS09340 1585639..1585827 - 189 WP_003706568.1 hypothetical protein -
WHOZ_RS09345 1586000..1586227 + 228 WP_003698261.1 helix-turn-helix domain-containing protein -
WHOZ_RS09350 1586345..1587409 + 1065 WP_003689134.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1566634..1601099 34465


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T293196 WP_003689143.1 NZ_LT592146:c1582491-1582309 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT293196 WP_003691454.1 NZ_LT592146:c1582207-1581806 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References