Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 657255..657910 | Replicon | chromosome |
| Accession | NZ_LT592146 | ||
| Organism | Neisseria gonorrhoeae strain WHO O | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q5F882 |
| Locus tag | WHOZ_RS04110 | Protein ID | WP_003691083.1 |
| Coordinates | 657491..657910 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | WHOZ_RS04105 | Protein ID | WP_003688410.1 |
| Coordinates | 657255..657491 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WHOZ_RS04070 | 652389..652676 | + | 288 | WP_025455945.1 | hypothetical protein | - |
| WHOZ_RS04075 | 652748..653914 | + | 1167 | WP_047919363.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| WHOZ_RS04080 | 653925..654815 | + | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
| WHOZ_RS04085 | 655198..655584 | - | 387 | Protein_675 | IS110 family transposase | - |
| WHOZ_RS04090 | 655796..656224 | + | 429 | WP_003701165.1 | helix-turn-helix domain-containing protein | - |
| WHOZ_RS04095 | 656229..656807 | + | 579 | WP_003697246.1 | IS3 family transposase | - |
| WHOZ_RS04100 | 656804..657049 | + | 246 | WP_003706295.1 | IS3 family transposase | - |
| WHOZ_RS04105 | 657255..657491 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| WHOZ_RS04110 | 657491..657910 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| WHOZ_RS04115 | 658059..659513 | - | 1455 | WP_003688412.1 | iron-sulfur cluster-binding protein | - |
| WHOZ_RS04120 | 659510..660211 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
| WHOZ_RS04125 | 660208..660987 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
| WHOZ_RS04130 | 661135..662676 | + | 1542 | WP_003697015.1 | multidrug efflux MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 655132..655605 | 473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T293195 WP_003691083.1 NZ_LT592146:657491-657910 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|