Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1535607..1536292 | Replicon | chromosome |
| Accession | NZ_LT591910 | ||
| Organism | Neisseria gonorrhoeae strain WHO N | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | E4V86_RS08955 | Protein ID | WP_003689143.1 |
| Coordinates | 1536110..1536292 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | E4V86_RS08950 | Protein ID | WP_003691454.1 |
| Coordinates | 1535607..1536008 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E4V86_RS08900 | 1531036..1531218 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| E4V86_RS08905 | 1531358..1532044 | - | 687 | WP_010357532.1 | hypothetical protein | - |
| E4V86_RS08910 | 1532113..1532274 | - | 162 | WP_003693867.1 | hypothetical protein | - |
| E4V86_RS08915 | 1532271..1532546 | - | 276 | WP_071226670.1 | hypothetical protein | - |
| E4V86_RS08920 | 1532701..1533033 | - | 333 | WP_003698216.1 | hypothetical protein | - |
| E4V86_RS08925 | 1533174..1533467 | - | 294 | WP_144894349.1 | hypothetical protein | - |
| E4V86_RS08930 | 1533464..1533940 | - | 477 | WP_002255718.1 | hypothetical protein | - |
| E4V86_RS08935 | 1533973..1534173 | - | 201 | WP_003687954.1 | hypothetical protein | - |
| E4V86_RS08940 | 1534414..1534830 | - | 417 | WP_003693479.1 | hypothetical protein | - |
| E4V86_RS08945 | 1534839..1535423 | - | 585 | WP_003693477.1 | SocA family protein | - |
| E4V86_RS08950 | 1535607..1536008 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| E4V86_RS08955 | 1536110..1536292 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| E4V86_RS08960 | 1536462..1537280 | - | 819 | WP_047951318.1 | DUF3037 domain-containing protein | - |
| E4V86_RS08965 | 1537553..1538308 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| E4V86_RS08970 | 1538445..1538630 | + | 186 | WP_002238713.1 | Cro/Cl family transcriptional regulator | - |
| E4V86_RS08975 | 1538719..1538874 | + | 156 | WP_003689578.1 | hypothetical protein | - |
| E4V86_RS08980 | 1538851..1539039 | - | 189 | WP_003696008.1 | hypothetical protein | - |
| E4V86_RS08985 | 1539212..1539439 | + | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| E4V86_RS08990 | 1539436..1540476 | + | 1041 | WP_134472161.1 | helix-turn-helix domain-containing protein | - |
| E4V86_RS08995 | 1540491..1541273 | + | 783 | WP_025456432.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1520053..1553369 | 33316 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T293193 WP_003689143.1 NZ_LT591910:c1536292-1536110 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT293193 WP_003691454.1 NZ_LT591910:c1536008-1535607 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|