Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1535607..1536292 Replicon chromosome
Accession NZ_LT591910
Organism Neisseria gonorrhoeae strain WHO N

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag E4V86_RS08955 Protein ID WP_003689143.1
Coordinates 1536110..1536292 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag E4V86_RS08950 Protein ID WP_003691454.1
Coordinates 1535607..1536008 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E4V86_RS08900 1531036..1531218 - 183 WP_003691535.1 hypothetical protein -
E4V86_RS08905 1531358..1532044 - 687 WP_010357532.1 hypothetical protein -
E4V86_RS08910 1532113..1532274 - 162 WP_003693867.1 hypothetical protein -
E4V86_RS08915 1532271..1532546 - 276 WP_071226670.1 hypothetical protein -
E4V86_RS08920 1532701..1533033 - 333 WP_003698216.1 hypothetical protein -
E4V86_RS08925 1533174..1533467 - 294 WP_144894349.1 hypothetical protein -
E4V86_RS08930 1533464..1533940 - 477 WP_002255718.1 hypothetical protein -
E4V86_RS08935 1533973..1534173 - 201 WP_003687954.1 hypothetical protein -
E4V86_RS08940 1534414..1534830 - 417 WP_003693479.1 hypothetical protein -
E4V86_RS08945 1534839..1535423 - 585 WP_003693477.1 SocA family protein -
E4V86_RS08950 1535607..1536008 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
E4V86_RS08955 1536110..1536292 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
E4V86_RS08960 1536462..1537280 - 819 WP_047951318.1 DUF3037 domain-containing protein -
E4V86_RS08965 1537553..1538308 - 756 WP_003693472.1 LexA family transcriptional regulator -
E4V86_RS08970 1538445..1538630 + 186 WP_002238713.1 Cro/Cl family transcriptional regulator -
E4V86_RS08975 1538719..1538874 + 156 WP_003689578.1 hypothetical protein -
E4V86_RS08980 1538851..1539039 - 189 WP_003696008.1 hypothetical protein -
E4V86_RS08985 1539212..1539439 + 228 WP_003691442.1 helix-turn-helix domain-containing protein -
E4V86_RS08990 1539436..1540476 + 1041 WP_134472161.1 helix-turn-helix domain-containing protein -
E4V86_RS08995 1540491..1541273 + 783 WP_025456432.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1520053..1553369 33316


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T293193 WP_003689143.1 NZ_LT591910:c1536292-1536110 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT293193 WP_003691454.1 NZ_LT591910:c1536008-1535607 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References