Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 727948..728603 | Replicon | chromosome |
Accession | NZ_LT591910 | ||
Organism | Neisseria gonorrhoeae strain WHO N |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | E4V86_RS04430 | Protein ID | WP_003691083.1 |
Coordinates | 728184..728603 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | E4V86_RS04425 | Protein ID | WP_003688410.1 |
Coordinates | 727948..728184 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4V86_RS04390 | 723082..723369 | + | 288 | WP_003688407.1 | hypothetical protein | - |
E4V86_RS04395 | 723441..724607 | + | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
E4V86_RS04400 | 724618..725508 | + | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
E4V86_RS04405 | 725891..726277 | - | 387 | Protein_754 | IS110 family transposase | - |
E4V86_RS04410 | 726489..726917 | + | 429 | WP_003701165.1 | helix-turn-helix domain-containing protein | - |
E4V86_RS04415 | 726922..727500 | + | 579 | WP_003688041.1 | IS3 family transposase | - |
E4V86_RS04420 | 727497..727742 | + | 246 | WP_003706295.1 | IS3 family transposase | - |
E4V86_RS04425 | 727948..728184 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
E4V86_RS04430 | 728184..728603 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
E4V86_RS04435 | 728752..730206 | - | 1455 | WP_003688412.1 | iron-sulfur cluster-binding protein | - |
E4V86_RS04440 | 730203..730904 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
E4V86_RS04445 | 730901..731680 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
E4V86_RS04450 | 731828..733369 | + | 1542 | WP_003693283.1 | multidrug efflux MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T293192 WP_003691083.1 NZ_LT591910:728184-728603 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|