Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1541784..1542469 | Replicon | chromosome |
| Accession | NZ_LT591904 | ||
| Organism | Neisseria gonorrhoeae strain WHO M | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | C7R98_RS09070 | Protein ID | WP_003689143.1 |
| Coordinates | 1542287..1542469 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | C7R98_RS09065 | Protein ID | WP_003691454.1 |
| Coordinates | 1541784..1542185 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7R98_RS09010 | 1536830..1537045 | - | 216 | WP_003691538.1 | hypothetical protein | - |
| C7R98_RS09015 | 1537097..1537588 | - | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| C7R98_RS09020 | 1537585..1537767 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| C7R98_RS09025 | 1537907..1538593 | - | 687 | WP_010359969.1 | hypothetical protein | - |
| C7R98_RS09030 | 1538662..1538823 | - | 162 | WP_003691530.1 | hypothetical protein | - |
| C7R98_RS09035 | 1538820..1539095 | - | 276 | WP_010359972.1 | hypothetical protein | - |
| C7R98_RS09040 | 1539249..1539581 | - | 333 | WP_047919601.1 | phage associated protein | - |
| C7R98_RS09045 | 1539722..1539997 | - | 276 | WP_050165047.1 | hypothetical protein | - |
| C7R98_RS09050 | 1539994..1540470 | - | 477 | WP_002255718.1 | hypothetical protein | - |
| C7R98_RS09055 | 1540503..1540703 | - | 201 | WP_003687954.1 | hypothetical protein | - |
| C7R98_RS09060 | 1540903..1541685 | + | 783 | WP_003689146.1 | hypothetical protein | - |
| C7R98_RS09065 | 1541784..1542185 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| C7R98_RS09070 | 1542287..1542469 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| C7R98_RS09075 | 1542639..1543457 | - | 819 | WP_012503752.1 | DUF3037 domain-containing protein | - |
| C7R98_RS09080 | 1543454..1544152 | - | 699 | WP_003689139.1 | hypothetical protein | - |
| C7R98_RS09085 | 1544391..1545089 | - | 699 | WP_002212401.1 | helix-turn-helix domain-containing protein | - |
| C7R98_RS09090 | 1545129..1545815 | - | 687 | WP_012503751.1 | helix-turn-helix transcriptional regulator | - |
| C7R98_RS09095 | 1545980..1546165 | + | 186 | WP_048654326.1 | helix-turn-helix domain-containing protein | - |
| C7R98_RS13655 | 1546167..1546367 | + | 201 | WP_012503750.1 | hypothetical protein | - |
| C7R98_RS09105 | 1546564..1547370 | + | 807 | WP_050154472.1 | replication protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1526601..1560274 | 33673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T293189 WP_003689143.1 NZ_LT591904:c1542469-1542287 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT293189 WP_003691454.1 NZ_LT591904:c1542185-1541784 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|