293189

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1541784..1542469 Replicon chromosome
Accession NZ_LT591904
Organism Neisseria gonorrhoeae strain WHO M

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag C7R98_RS09070 Protein ID WP_003689143.1
Coordinates 1542287..1542469 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag C7R98_RS09065 Protein ID WP_003691454.1
Coordinates 1541784..1542185 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C7R98_RS09010 1536830..1537045 - 216 WP_003691538.1 hypothetical protein -
C7R98_RS09015 1537097..1537588 - 492 WP_003691537.1 siphovirus Gp157 family protein -
C7R98_RS09020 1537585..1537767 - 183 WP_003691535.1 hypothetical protein -
C7R98_RS09025 1537907..1538593 - 687 WP_010359969.1 hypothetical protein -
C7R98_RS09030 1538662..1538823 - 162 WP_003691530.1 hypothetical protein -
C7R98_RS09035 1538820..1539095 - 276 WP_010359972.1 hypothetical protein -
C7R98_RS09040 1539249..1539581 - 333 WP_047919601.1 phage associated protein -
C7R98_RS09045 1539722..1539997 - 276 WP_050165047.1 hypothetical protein -
C7R98_RS09050 1539994..1540470 - 477 WP_002255718.1 hypothetical protein -
C7R98_RS09055 1540503..1540703 - 201 WP_003687954.1 hypothetical protein -
C7R98_RS09060 1540903..1541685 + 783 WP_003689146.1 hypothetical protein -
C7R98_RS09065 1541784..1542185 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
C7R98_RS09070 1542287..1542469 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
C7R98_RS09075 1542639..1543457 - 819 WP_012503752.1 DUF3037 domain-containing protein -
C7R98_RS09080 1543454..1544152 - 699 WP_003689139.1 hypothetical protein -
C7R98_RS09085 1544391..1545089 - 699 WP_002212401.1 helix-turn-helix domain-containing protein -
C7R98_RS09090 1545129..1545815 - 687 WP_012503751.1 helix-turn-helix transcriptional regulator -
C7R98_RS09095 1545980..1546165 + 186 WP_048654326.1 helix-turn-helix domain-containing protein -
C7R98_RS13655 1546167..1546367 + 201 WP_012503750.1 hypothetical protein -
C7R98_RS09105 1546564..1547370 + 807 WP_050154472.1 replication protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1526601..1560274 33673


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T293189 WP_003689143.1 NZ_LT591904:c1542469-1542287 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT293189 WP_003691454.1 NZ_LT591904:c1542185-1541784 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References