Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1942572..1943257 Replicon chromosome
Accession NZ_LT591901
Organism Neisseria gonorrhoeae strain WHO L

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag C7S00_RS11430 Protein ID WP_003689143.1
Coordinates 1942572..1942754 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag C7S00_RS11435 Protein ID WP_003691454.1
Coordinates 1942856..1943257 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C7S00_RS11385 1937656..1938720 - 1065 WP_003689134.1 hypothetical protein -
C7S00_RS11390 1938838..1939065 - 228 WP_003698261.1 helix-turn-helix domain-containing protein -
C7S00_RS11395 1939238..1939426 + 189 WP_003691445.1 hypothetical protein -
C7S00_RS11400 1939403..1939558 - 156 WP_003691446.1 hypothetical protein -
C7S00_RS11405 1939638..1939826 - 189 WP_003689136.1 helix-turn-helix domain-containing protein -
C7S00_RS11410 1939942..1940652 + 711 WP_025455806.1 helix-turn-helix transcriptional regulator -
C7S00_RS11420 1940889..1941587 + 699 WP_003689139.1 hypothetical protein -
C7S00_RS11425 1941584..1942402 + 819 WP_025455900.1 DUF3037 domain-containing protein -
C7S00_RS11430 1942572..1942754 + 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
C7S00_RS11435 1942856..1943257 + 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
C7S00_RS11440 1943356..1944138 - 783 WP_003689146.1 hypothetical protein -
C7S00_RS11445 1944328..1944528 + 201 WP_047920804.1 hypothetical protein -
C7S00_RS11450 1944561..1945037 + 477 WP_002255718.1 hypothetical protein -
C7S00_RS11455 1945034..1945315 + 282 WP_144961335.1 hypothetical protein -
C7S00_RS11460 1945457..1945789 + 333 WP_047923919.1 hypothetical protein -
C7S00_RS11465 1945942..1946220 + 279 WP_047921031.1 hypothetical protein -
C7S00_RS11470 1946217..1946378 + 162 WP_003693867.1 hypothetical protein -
C7S00_RS11475 1946447..1947133 + 687 WP_047921032.1 hypothetical protein -
C7S00_RS11480 1947273..1947455 + 183 WP_003691535.1 hypothetical protein -
C7S00_RS11485 1947452..1947943 + 492 WP_003691537.1 siphovirus Gp157 family protein -
C7S00_RS11490 1947995..1948210 + 216 WP_003691538.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1924179..1958439 34260


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T293186 WP_003689143.1 NZ_LT591901:1942572-1942754 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT293186 WP_003691454.1 NZ_LT591901:1942856-1943257 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References