Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 1116881..1117536 | Replicon | chromosome |
Accession | NZ_LT591901 | ||
Organism | Neisseria gonorrhoeae strain WHO L |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | C7S00_RS06380 | Protein ID | WP_003691083.1 |
Coordinates | 1116881..1117300 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | C7S00_RS06385 | Protein ID | WP_003688410.1 |
Coordinates | 1117300..1117536 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C7S00_RS06360 | 1112115..1113656 | - | 1542 | WP_003701286.1 | multidrug efflux MFS transporter | - |
C7S00_RS06365 | 1113804..1114583 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
C7S00_RS06370 | 1114580..1115281 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
C7S00_RS06375 | 1115278..1116732 | + | 1455 | WP_003688412.1 | iron-sulfur cluster-binding protein | - |
C7S00_RS06380 | 1116881..1117300 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
C7S00_RS06385 | 1117300..1117536 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
C7S00_RS06390 | 1117742..1117939 | - | 198 | WP_033910354.1 | IS3 family transposase | - |
C7S00_RS06395 | 1117984..1118562 | - | 579 | WP_003688041.1 | IS3 family transposase | - |
C7S00_RS06400 | 1118567..1118995 | - | 429 | WP_010360042.1 | helix-turn-helix domain-containing protein | - |
C7S00_RS06405 | 1119207..1119593 | + | 387 | Protein_1107 | IS110 family transposase | - |
C7S00_RS06410 | 1119976..1120866 | - | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
C7S00_RS06415 | 1120877..1122043 | - | 1167 | WP_003701280.1 | ADP-forming succinate--CoA ligase subunit beta | - |
C7S00_RS06420 | 1122115..1122402 | - | 288 | WP_025455945.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T293185 WP_003691083.1 NZ_LT591901:c1117300-1116881 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|