Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1719968..1720653 | Replicon | chromosome |
| Accession | NZ_LT591897 | ||
| Organism | Neisseria gonorrhoeae strain WHO F | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | C7S05_RS09990 | Protein ID | WP_003689143.1 |
| Coordinates | 1720471..1720653 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | C7S05_RS09985 | Protein ID | WP_003691454.1 |
| Coordinates | 1719968..1720369 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7S05_RS09935 | 1715445..1715660 | - | 216 | WP_017146748.1 | hypothetical protein | - |
| C7S05_RS09940 | 1715712..1716203 | - | 492 | WP_047924243.1 | siphovirus Gp157 family protein | - |
| C7S05_RS09945 | 1716200..1716382 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| C7S05_RS09950 | 1716522..1717208 | - | 687 | WP_010951053.1 | hypothetical protein | - |
| C7S05_RS09955 | 1717277..1717438 | - | 162 | WP_047924242.1 | hypothetical protein | - |
| C7S05_RS09960 | 1717435..1717710 | - | 276 | WP_082277470.1 | hypothetical protein | - |
| C7S05_RS09965 | 1717863..1718195 | - | 333 | WP_003694992.1 | hypothetical protein | - |
| C7S05_RS09970 | 1718336..1718536 | - | 201 | WP_047924274.1 | hypothetical protein | - |
| C7S05_RS09975 | 1718777..1719193 | - | 417 | WP_003693479.1 | hypothetical protein | - |
| C7S05_RS09980 | 1719202..1719786 | - | 585 | WP_003693477.1 | SocA family protein | - |
| C7S05_RS09985 | 1719968..1720369 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| C7S05_RS09990 | 1720471..1720653 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| C7S05_RS09995 | 1720823..1721641 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| C7S05_RS10000 | 1721916..1722671 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| C7S05_RS10005 | 1722808..1722993 | + | 186 | WP_002238713.1 | Cro/Cl family transcriptional regulator | - |
| C7S05_RS10010 | 1723082..1723237 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| C7S05_RS10015 | 1723214..1723402 | - | 189 | WP_047924197.1 | hypothetical protein | - |
| C7S05_RS10020 | 1723576..1723803 | + | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| C7S05_RS10025 | 1723921..1724986 | + | 1066 | Protein_1758 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1704454..1738666 | 34212 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T293182 WP_003689143.1 NZ_LT591897:c1720653-1720471 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT293182 WP_003691454.1 NZ_LT591897:c1720369-1719968 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|