Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1719968..1720653 Replicon chromosome
Accession NZ_LT591897
Organism Neisseria gonorrhoeae strain WHO F

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag C7S05_RS09990 Protein ID WP_003689143.1
Coordinates 1720471..1720653 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag C7S05_RS09985 Protein ID WP_003691454.1
Coordinates 1719968..1720369 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C7S05_RS09935 1715445..1715660 - 216 WP_017146748.1 hypothetical protein -
C7S05_RS09940 1715712..1716203 - 492 WP_047924243.1 siphovirus Gp157 family protein -
C7S05_RS09945 1716200..1716382 - 183 WP_003691535.1 hypothetical protein -
C7S05_RS09950 1716522..1717208 - 687 WP_010951053.1 hypothetical protein -
C7S05_RS09955 1717277..1717438 - 162 WP_047924242.1 hypothetical protein -
C7S05_RS09960 1717435..1717710 - 276 WP_082277470.1 hypothetical protein -
C7S05_RS09965 1717863..1718195 - 333 WP_003694992.1 hypothetical protein -
C7S05_RS09970 1718336..1718536 - 201 WP_047924274.1 hypothetical protein -
C7S05_RS09975 1718777..1719193 - 417 WP_003693479.1 hypothetical protein -
C7S05_RS09980 1719202..1719786 - 585 WP_003693477.1 SocA family protein -
C7S05_RS09985 1719968..1720369 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
C7S05_RS09990 1720471..1720653 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
C7S05_RS09995 1720823..1721641 - 819 WP_003693474.1 DUF3037 domain-containing protein -
C7S05_RS10000 1721916..1722671 - 756 WP_003693472.1 LexA family transcriptional regulator -
C7S05_RS10005 1722808..1722993 + 186 WP_002238713.1 Cro/Cl family transcriptional regulator -
C7S05_RS10010 1723082..1723237 + 156 WP_003698902.1 hypothetical protein -
C7S05_RS10015 1723214..1723402 - 189 WP_047924197.1 hypothetical protein -
C7S05_RS10020 1723576..1723803 + 228 WP_003698261.1 helix-turn-helix domain-containing protein -
C7S05_RS10025 1723921..1724986 + 1066 Protein_1758 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1704454..1738666 34212


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T293182 WP_003689143.1 NZ_LT591897:c1720653-1720471 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT293182 WP_003691454.1 NZ_LT591897:c1720369-1719968 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References