Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1562413..1562872 Replicon chromosome
Accession NZ_LT591897
Organism Neisseria gonorrhoeae strain WHO F

Toxin (Protein)


Gene name relE Uniprot ID A0A7H9WCT3
Locus tag C7S05_RS09010 Protein ID WP_047924599.1
Coordinates 1562413..1562685 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A7H9WQT3
Locus tag C7S05_RS09015 Protein ID WP_047922294.1
Coordinates 1562675..1562872 (-) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C7S05_RS08965 1557740..1558303 + 564 WP_047922373.1 mobilization protein -
C7S05_RS08970 1558287..1559331 + 1045 Protein_1581 traS protein -
C7S05_RS08975 1559426..1559878 + 453 WP_047922361.1 hypothetical protein -
C7S05_RS08980 1560029..1560445 + 417 WP_047922360.1 hypothetical protein -
C7S05_RS08990 1561077..1561475 + 399 WP_047922372.1 hypothetical protein -
C7S05_RS08995 1561570..1561848 - 279 WP_047922359.1 virulence factor -
C7S05_RS09000 1561848..1562042 - 195 WP_047922358.1 DUF5397 domain-containing protein -
C7S05_RS09010 1562413..1562685 - 273 WP_047924599.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
C7S05_RS09015 1562675..1562872 - 198 WP_047922294.1 hypothetical protein Antitoxin
C7S05_RS09020 1563476..1564258 - 783 WP_053014439.1 hypothetical protein -
C7S05_RS09025 1564271..1564471 - 201 WP_082284962.1 helix-turn-helix domain-containing protein -
C7S05_RS09030 1564601..1565200 + 600 WP_047922263.1 helix-turn-helix domain-containing protein -
C7S05_RS09035 1565809..1566210 + 402 WP_047922264.1 hypothetical protein -
C7S05_RS09040 1566348..1566899 + 552 WP_082284961.1 hypothetical protein -
C7S05_RS09045 1567025..1567771 + 747 WP_047922268.1 cobalamin biosynthesis protein CobQ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1537496..1569588 32092


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10318.73 Da        Isoelectric Point: 5.6032

>T293181 WP_047924599.1 NZ_LT591897:c1562685-1562413 [Neisseria gonorrhoeae]
MQINWSTEANEDLNEITDFIADDSPVAAVNLSEHLFETAEKIGQMPYMGRKGRVAGTREFVAHPNYILVYQVKLDEIRIL
RVLHGSRKYP

Download         Length: 273 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 7418.36 Da        Isoelectric Point: 6.4598

>AT293181 WP_047922294.1 NZ_LT591897:c1562872-1562675 [Neisseria gonorrhoeae]
MNTALKLHDDPLVYEFSNKTDAADYDEWFRAKVNAALNSDKPAIPHDEVVAKMRAKMAERLRNAN

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7H9WCT3

Antitoxin

Source ID Structure
AlphaFold DB A0A7H9WQT3

References