293179

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1044307..1044766 Replicon chromosome
Accession NZ_LT591897
Organism Neisseria gonorrhoeae strain WHO F

Toxin (Protein)


Gene name relE Uniprot ID A0A7H9WCT3
Locus tag C7S05_RS06030 Protein ID WP_047924599.1
Coordinates 1044307..1044579 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A7H9WQT3
Locus tag C7S05_RS06035 Protein ID WP_047922294.1
Coordinates 1044569..1044766 (-) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C7S05_RS05985 1039636..1040199 + 564 WP_047922373.1 mobilization protein -
C7S05_RS05990 1040183..1041226 + 1044 WP_047922362.1 traS protein -
C7S05_RS05995 1041321..1041773 + 453 WP_047922361.1 hypothetical protein -
C7S05_RS06000 1041923..1042339 + 417 WP_047922360.1 hypothetical protein -
C7S05_RS06010 1042971..1043369 + 399 WP_047922372.1 hypothetical protein -
C7S05_RS06015 1043464..1043742 - 279 WP_047922359.1 virulence factor -
C7S05_RS06020 1043742..1043936 - 195 WP_047922358.1 DUF5397 domain-containing protein -
C7S05_RS06030 1044307..1044579 - 273 WP_047924599.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
C7S05_RS06035 1044569..1044766 - 198 WP_047922294.1 hypothetical protein Antitoxin
C7S05_RS06040 1045369..1046151 - 783 WP_053014439.1 hypothetical protein -
C7S05_RS06045 1046164..1046364 - 201 WP_082284962.1 helix-turn-helix domain-containing protein -
C7S05_RS06050 1046494..1047093 + 600 WP_047922263.1 helix-turn-helix domain-containing protein -
C7S05_RS06055 1047702..1048103 + 402 WP_047922264.1 hypothetical protein -
C7S05_RS06060 1048241..1048792 + 552 WP_082284961.1 hypothetical protein -
C7S05_RS06065 1048918..1049664 + 747 WP_047922268.1 cobalamin biosynthesis protein CobQ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1019397..1051481 32084


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10318.73 Da        Isoelectric Point: 5.6032

>T293179 WP_047924599.1 NZ_LT591897:c1044579-1044307 [Neisseria gonorrhoeae]
MQINWSTEANEDLNEITDFIADDSPVAAVNLSEHLFETAEKIGQMPYMGRKGRVAGTREFVAHPNYILVYQVKLDEIRIL
RVLHGSRKYP

Download         Length: 273 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 7418.36 Da        Isoelectric Point: 6.4598

>AT293179 WP_047922294.1 NZ_LT591897:c1044766-1044569 [Neisseria gonorrhoeae]
MNTALKLHDDPLVYEFSNKTDAADYDEWFRAKVNAALNSDKPAIPHDEVVAKMRAKMAERLRNAN

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7H9WCT3

Antitoxin

Source ID Structure
AlphaFold DB A0A7H9WQT3

References