Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | VapXD/- |
Location | 1043464..1043936 | Replicon | chromosome |
Accession | NZ_LT591897 | ||
Organism | Neisseria gonorrhoeae strain WHO F |
Toxin (Protein)
Gene name | VapD | Uniprot ID | A0A7H9WAT6 |
Locus tag | C7S05_RS06015 | Protein ID | WP_047922359.1 |
Coordinates | 1043464..1043742 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | VapX | Uniprot ID | A0A7H9WP50 |
Locus tag | C7S05_RS06020 | Protein ID | WP_047922358.1 |
Coordinates | 1043742..1043936 (-) | Length | 65 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C7S05_RS05985 | 1039636..1040199 | + | 564 | WP_047922373.1 | mobilization protein | - |
C7S05_RS05990 | 1040183..1041226 | + | 1044 | WP_047922362.1 | traS protein | - |
C7S05_RS05995 | 1041321..1041773 | + | 453 | WP_047922361.1 | hypothetical protein | - |
C7S05_RS06000 | 1041923..1042339 | + | 417 | WP_047922360.1 | hypothetical protein | - |
C7S05_RS06010 | 1042971..1043369 | + | 399 | WP_047922372.1 | hypothetical protein | - |
C7S05_RS06015 | 1043464..1043742 | - | 279 | WP_047922359.1 | virulence factor | Toxin |
C7S05_RS06020 | 1043742..1043936 | - | 195 | WP_047922358.1 | DUF5397 domain-containing protein | Antitoxin |
C7S05_RS06030 | 1044307..1044579 | - | 273 | WP_047924599.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
C7S05_RS06035 | 1044569..1044766 | - | 198 | WP_047922294.1 | hypothetical protein | - |
C7S05_RS06040 | 1045369..1046151 | - | 783 | WP_053014439.1 | hypothetical protein | - |
C7S05_RS06045 | 1046164..1046364 | - | 201 | WP_082284962.1 | helix-turn-helix domain-containing protein | - |
C7S05_RS06050 | 1046494..1047093 | + | 600 | WP_047922263.1 | helix-turn-helix domain-containing protein | - |
C7S05_RS06055 | 1047702..1048103 | + | 402 | WP_047922264.1 | hypothetical protein | - |
C7S05_RS06060 | 1048241..1048792 | + | 552 | WP_082284961.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1019397..1051481 | 32084 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10429.79 Da Isoelectric Point: 5.7296
>T293178 WP_047922359.1 NZ_LT591897:c1043742-1043464 [Neisseria gonorrhoeae]
MYAISFDLVVADTAQNHPKGISQAYADIGYTLRQFGFTRVQGGLYTCQNEDMANLFSAINELKALPWFPSSVRDIRAFRI
EQWSDFTSLVKS
MYAISFDLVVADTAQNHPKGISQAYADIGYTLRQFGFTRVQGGLYTCQNEDMANLFSAINELKALPWFPSSVRDIRAFRI
EQWSDFTSLVKS
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7H9WAT6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7H9WP50 |