Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 947644..948299 | Replicon | chromosome |
| Accession | NZ_LT591897 | ||
| Organism | Neisseria gonorrhoeae strain WHO F | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q5F882 |
| Locus tag | C7S05_RS05445 | Protein ID | WP_003691083.1 |
| Coordinates | 947644..948063 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | C7S05_RS05450 | Protein ID | WP_003688410.1 |
| Coordinates | 948063..948299 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7S05_RS05425 | 942878..944419 | - | 1542 | WP_003701286.1 | multidrug efflux MFS transporter | - |
| C7S05_RS05430 | 944567..945346 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
| C7S05_RS05435 | 945343..946044 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
| C7S05_RS05440 | 946041..947495 | + | 1455 | WP_003701282.1 | iron-sulfur cluster-binding protein | - |
| C7S05_RS05445 | 947644..948063 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| C7S05_RS05450 | 948063..948299 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| C7S05_RS05455 | 948505..948702 | - | 198 | WP_033910354.1 | IS3 family transposase | - |
| C7S05_RS05460 | 948747..949325 | - | 579 | WP_003688041.1 | IS3 family transposase | - |
| C7S05_RS05465 | 949330..949758 | - | 429 | WP_003701165.1 | helix-turn-helix domain-containing protein | - |
| C7S05_RS05475 | 949970..950501 | + | 532 | Protein_960 | IS110 family transposase | - |
| C7S05_RS05480 | 950739..951629 | - | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
| C7S05_RS05485 | 951640..952806 | - | 1167 | WP_003701280.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| C7S05_RS05490 | 952878..953165 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T293177 WP_003691083.1 NZ_LT591897:c948063-947644 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|