Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2959559..2960169 | Replicon | chromosome |
Accession | NZ_LT578417 | ||
Organism | Cyanobium sp. NIES-981 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | CBM981_RS14845 | Protein ID | WP_087069028.1 |
Coordinates | 2959559..2959864 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | CBM981_RS14850 | Protein ID | WP_087069029.1 |
Coordinates | 2959861..2960169 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CBM981_RS14825 | 2955222..2955628 | + | 407 | Protein_2946 | tyrosine-type recombinase/integrase | - |
CBM981_RS14830 | 2955824..2956057 | + | 234 | WP_087069026.1 | DUF4160 domain-containing protein | - |
CBM981_RS14835 | 2956050..2956310 | + | 261 | WP_087069027.1 | DUF2442 domain-containing protein | - |
CBM981_RS15515 | 2956426..2957400 | + | 975 | WP_157665490.1 | hypothetical protein | - |
CBM981_RS14840 | 2957515..2958942 | + | 1428 | Protein_2950 | IS5 family transposase | - |
CBM981_RS14845 | 2959559..2959864 | + | 306 | WP_087069028.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CBM981_RS14850 | 2959861..2960169 | + | 309 | WP_087069029.1 | putative addiction module antidote protein | Antitoxin |
CBM981_RS14855 | 2960377..2962041 | - | 1665 | WP_157665491.1 | hypothetical protein | - |
CBM981_RS14865 | 2963977..2964780 | + | 804 | WP_087067390.1 | IS21-like element helper ATPase IstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2956417..2967223 | 10806 | |
- | flank | IS/Tn | - | - | 2957464..2959041 | 1577 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11108.85 Da Isoelectric Point: 10.1314
>T293175 WP_087069028.1 NZ_LT578417:2959559-2959864 [Cyanobium sp. NIES-981]
MVEVRQAERFVRWLEGLRDLKGRAKVLARIERLIGGNPGDVRPVGGGVSELRINYGPGYRVYYLQKGTTLIILLAGGDKS
SQAKDIGEALLLAINLSEESR
MVEVRQAERFVRWLEGLRDLKGRAKVLARIERLIGGNPGDVRPVGGGVSELRINYGPGYRVYYLQKGTTLIILLAGGDKS
SQAKDIGEALLLAINLSEESR
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|