Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 1508019..1508599 | Replicon | chromosome |
Accession | NZ_LT578417 | ||
Organism | Cyanobium sp. NIES-981 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | CBM981_RS07715 | Protein ID | WP_087069278.1 |
Coordinates | 1508237..1508599 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | CBM981_RS07710 | Protein ID | WP_087067940.1 |
Coordinates | 1508019..1508240 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CBM981_RS07695 | 1504396..1504605 | - | 210 | WP_087067938.1 | HypC/HybG/HupF family hydrogenase formation chaperone | - |
CBM981_RS07700 | 1504565..1507015 | - | 2451 | WP_087067939.1 | carbamoyltransferase HypF | - |
CBM981_RS07705 | 1507012..1507722 | - | 711 | WP_087069277.1 | hydrogenase nickel incorporation protein HypB | - |
CBM981_RS07710 | 1508019..1508240 | + | 222 | WP_087067940.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
CBM981_RS07715 | 1508237..1508599 | + | 363 | WP_087069278.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
CBM981_RS07720 | 1508609..1508950 | - | 342 | WP_087067941.1 | hydrogenase maturation nickel metallochaperone HypA | - |
CBM981_RS07725 | 1508943..1509404 | - | 462 | WP_157665377.1 | hydrogenase maturation protease | - |
CBM981_RS07730 | 1509519..1509707 | - | 189 | WP_087067943.1 | hypothetical protein | - |
CBM981_RS07735 | 1509897..1511111 | + | 1215 | WP_087067944.1 | DUF2235 domain-containing protein | - |
CBM981_RS07740 | 1511246..1511449 | + | 204 | WP_087067945.1 | hypothetical protein | - |
CBM981_RS07745 | 1511510..1512205 | + | 696 | WP_087067946.1 | response regulator transcription factor | - |
CBM981_RS07750 | 1512309..1513103 | - | 795 | WP_087067947.1 | transglutaminase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13518.85 Da Isoelectric Point: 6.4577
>T293171 WP_087069278.1 NZ_LT578417:1508237-1508599 [Cyanobium sp. NIES-981]
MMLLLDTNLLIDVLRGEAVALRWLAEQQRPSISVITWIEVLVGCRQGEQERVEGWLQAFPRLPLDQAVARESVLLRQRHG
LKVPDAIILATARCAGLTLATRNVRDFPLELGDVLHPYTL
MMLLLDTNLLIDVLRGEAVALRWLAEQQRPSISVITWIEVLVGCRQGEQERVEGWLQAFPRLPLDQAVARESVLLRQRHG
LKVPDAIILATARCAGLTLATRNVRDFPLELGDVLHPYTL
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|