Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1443529..1444328 | Replicon | chromosome |
Accession | NZ_LT578417 | ||
Organism | Cyanobium sp. NIES-981 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | CBM981_RS07380 | Protein ID | WP_087067876.1 |
Coordinates | 1443810..1444328 (+) | Length | 173 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | CBM981_RS07375 | Protein ID | WP_087067890.1 |
Coordinates | 1443529..1443813 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CBM981_RS07340 | 1438924..1439727 | - | 804 | WP_087067390.1 | IS21-like element helper ATPase IstB | - |
CBM981_RS07350 | 1441339..1441968 | + | 630 | WP_087067885.1 | Fic family protein | - |
CBM981_RS07360 | 1442622..1442831 | - | 210 | WP_087067887.1 | hypothetical protein | - |
CBM981_RS07365 | 1442828..1443088 | - | 261 | WP_157665371.1 | addiction module protein | - |
CBM981_RS07370 | 1443210..1443473 | + | 264 | Protein_1470 | AAA family ATPase | - |
CBM981_RS07375 | 1443529..1443813 | + | 285 | WP_087067890.1 | DUF1778 domain-containing protein | Antitoxin |
CBM981_RS07380 | 1443810..1444328 | + | 519 | WP_087067876.1 | GNAT family N-acetyltransferase | Toxin |
CBM981_RS07390 | 1444828..1446646 | + | 1819 | Protein_1473 | DUF2075 domain-containing protein | - |
CBM981_RS07395 | 1446827..1447372 | + | 546 | WP_087067891.1 | J domain-containing protein | - |
CBM981_RS07400 | 1447384..1448460 | + | 1077 | WP_157665372.1 | hypothetical protein | - |
CBM981_RS07405 | 1448678..1449175 | - | 498 | WP_087067893.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1441438..1465209 | 23771 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 173 a.a. Molecular weight: 18921.87 Da Isoelectric Point: 9.5432
>T293170 WP_087067876.1 NZ_LT578417:1443810-1444328 [Cyanobium sp. NIES-981]
MSATYRSPRLLAAADRLDGFECRSEEQTIWLRKHARQAHARGGTSRVFVVTEVGGSDVVAYYAWCMASLTAVEAPPRLRK
GAGRYPQPVALLARLGVDLHHERRGLGAALLADVISRTAQIGTEVGCRGLLVHAESTAARAFYLHLIPEFEPSPTDPLHL
VLLMKDILRTLR
MSATYRSPRLLAAADRLDGFECRSEEQTIWLRKHARQAHARGGTSRVFVVTEVGGSDVVAYYAWCMASLTAVEAPPRLRK
GAGRYPQPVALLARLGVDLHHERRGLGAALLADVISRTAQIGTEVGCRGLLVHAESTAARAFYLHLIPEFEPSPTDPLHL
VLLMKDILRTLR
Download Length: 519 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|