Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1432604..1433403 | Replicon | chromosome |
Accession | NZ_LT578417 | ||
Organism | Cyanobium sp. NIES-981 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | CBM981_RS07290 | Protein ID | WP_087067876.1 |
Coordinates | 1432885..1433403 (+) | Length | 173 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | CBM981_RS07285 | Protein ID | WP_087067875.1 |
Coordinates | 1432604..1432888 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CBM981_RS07245 | 1427852..1428376 | - | 525 | WP_087067871.1 | dCTP deaminase | - |
CBM981_RS07250 | 1428436..1428621 | + | 186 | WP_087069268.1 | hypothetical protein | - |
CBM981_RS07255 | 1428644..1429219 | - | 576 | WP_087069269.1 | DUF1211 domain-containing protein | - |
CBM981_RS07260 | 1429300..1430238 | - | 939 | WP_087067872.1 | hypothetical protein | - |
CBM981_RS07265 | 1430502..1431616 | + | 1115 | WP_087066678.1 | IS3 family transposase | - |
CBM981_RS07275 | 1431885..1432295 | + | 411 | WP_087067874.1 | hypothetical protein | - |
CBM981_RS07285 | 1432604..1432888 | + | 285 | WP_087067875.1 | DUF1778 domain-containing protein | Antitoxin |
CBM981_RS07290 | 1432885..1433403 | + | 519 | WP_087067876.1 | GNAT family N-acetyltransferase | Toxin |
CBM981_RS07295 | 1433738..1434238 | - | 501 | WP_087067877.1 | GNAT family N-acetyltransferase | - |
CBM981_RS07300 | 1434235..1434528 | - | 294 | WP_087067878.1 | DUF1778 domain-containing protein | - |
CBM981_RS07305 | 1434932..1435348 | - | 417 | WP_087067879.1 | hypothetical protein | - |
CBM981_RS07310 | 1435357..1435626 | - | 270 | WP_087067880.1 | prevent-host-death protein | - |
CBM981_RS07320 | 1436381..1436647 | - | 267 | WP_087067881.1 | DUF1778 domain-containing protein | - |
CBM981_RS07325 | 1436728..1437111 | - | 384 | WP_087067882.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
CBM981_RS07330 | 1437108..1437368 | - | 261 | WP_087067883.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 173 a.a. Molecular weight: 18921.87 Da Isoelectric Point: 9.5432
>T293168 WP_087067876.1 NZ_LT578417:1432885-1433403 [Cyanobium sp. NIES-981]
MSATYRSPRLLAAADRLDGFECRSEEQTIWLRKHARQAHARGGTSRVFVVTEVGGSDVVAYYAWCMASLTAVEAPPRLRK
GAGRYPQPVALLARLGVDLHHERRGLGAALLADVISRTAQIGTEVGCRGLLVHAESTAARAFYLHLIPEFEPSPTDPLHL
VLLMKDILRTLR
MSATYRSPRLLAAADRLDGFECRSEEQTIWLRKHARQAHARGGTSRVFVVTEVGGSDVVAYYAWCMASLTAVEAPPRLRK
GAGRYPQPVALLARLGVDLHHERRGLGAALLADVISRTAQIGTEVGCRGLLVHAESTAARAFYLHLIPEFEPSPTDPLHL
VLLMKDILRTLR
Download Length: 519 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|