Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /GNAT-DUF1778 |
Location | 1619416..1620185 | Replicon | chromosome |
Accession | NZ_LT575468 | ||
Organism | Plesiomonas shigelloides strain NCTC10360 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | NCTC9997_RS07025 | Protein ID | WP_064977675.1 |
Coordinates | 1619416..1619913 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A379CP68 |
Locus tag | NCTC9997_RS07030 | Protein ID | WP_064977676.1 |
Coordinates | 1619913..1620185 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NCTC9997_RS07005 | 1614502..1614936 | - | 435 | WP_167550129.1 | phosphate-starvation-inducible PsiE family protein | - |
NCTC9997_RS07010 | 1615342..1615899 | + | 558 | WP_152135787.1 | hypothetical protein | - |
NCTC9997_RS07015 | 1616178..1616603 | - | 426 | WP_064977674.1 | GNAT family N-acetyltransferase | - |
NCTC9997_RS15225 | 1617446..1618024 | - | 579 | WP_197665254.1 | hypothetical protein | - |
NCTC9997_RS15230 | 1618008..1618466 | - | 459 | WP_197665255.1 | hypothetical protein | - |
NCTC9997_RS07025 | 1619416..1619913 | - | 498 | WP_064977675.1 | GNAT family N-acetyltransferase | Toxin |
NCTC9997_RS07030 | 1619913..1620185 | - | 273 | WP_064977676.1 | DUF1778 domain-containing protein | Antitoxin |
NCTC9997_RS07035 | 1620485..1620895 | + | 411 | WP_064977677.1 | glyoxalase | - |
NCTC9997_RS07040 | 1621646..1621834 | + | 189 | WP_156669252.1 | hypothetical protein | - |
NCTC9997_RS07045 | 1622323..1622574 | - | 252 | WP_064977679.1 | hypothetical protein | - |
NCTC9997_RS07050 | 1622999..1623502 | - | 504 | WP_082935587.1 | hypothetical protein | - |
NCTC9997_RS07055 | 1623607..1624314 | - | 708 | WP_064977681.1 | hypothetical protein | - |
NCTC9997_RS07060 | 1624409..1624696 | + | 288 | WP_064977682.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1551411..1630373 | 78962 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18590.30 Da Isoelectric Point: 7.3555
>T293166 WP_064977675.1 NZ_LT575468:c1619913-1619416 [Plesiomonas shigelloides]
METVLLDKSKHERHHFDCGVDALNNYLKVMASQQAKRDNSRTFVLEDDNDPRIIVGFYTLTMTPIDLKALPPQLQKKHQS
STSGGLIARLAIDKRYKGKGIGEWLLIDALKKLLQASNTVAFPVIIVDAKDGAENFYTKYGFTPFTETDNKLFITIADIR
SSLDE
METVLLDKSKHERHHFDCGVDALNNYLKVMASQQAKRDNSRTFVLEDDNDPRIIVGFYTLTMTPIDLKALPPQLQKKHQS
STSGGLIARLAIDKRYKGKGIGEWLLIDALKKLLQASNTVAFPVIIVDAKDGAENFYTKYGFTPFTETDNKLFITIADIR
SSLDE
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|