Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1851821..1852449 | Replicon | chromosome |
Accession | NZ_LT571436 | ||
Organism | Neisseria weaveri strain NCTC13585 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | A8Q77_RS08640 | Protein ID | WP_064130873.1 |
Coordinates | 1852048..1852449 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A3S4ZDA2 |
Locus tag | A8Q77_RS08635 | Protein ID | WP_004284447.1 |
Coordinates | 1851821..1852045 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A8Q77_RS08610 | 1847307..1847771 | - | 465 | WP_004284441.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
A8Q77_RS10710 | 1847837..1848550 | - | 714 | WP_172795948.1 | ComF family protein | - |
A8Q77_RS08620 | 1848549..1849292 | + | 744 | WP_004284444.1 | pimeloyl-ACP methyl ester esterase BioH | - |
A8Q77_RS08625 | 1849368..1850156 | + | 789 | WP_004284445.1 | methyltransferase domain-containing protein | - |
A8Q77_RS08630 | 1850308..1851675 | + | 1368 | WP_064130872.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE | - |
A8Q77_RS08635 | 1851821..1852045 | + | 225 | WP_004284447.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
A8Q77_RS08640 | 1852048..1852449 | + | 402 | WP_064130873.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
A8Q77_RS08645 | 1852808..1853977 | + | 1170 | WP_064130874.1 | benzoate/H(+) symporter BenE family transporter | - |
A8Q77_RS08650 | 1854228..1855649 | + | 1422 | WP_004284450.1 | alanine:cation symporter family protein | - |
A8Q77_RS08655 | 1855751..1856551 | - | 801 | WP_004284451.1 | cytochrome c biogenesis protein CcsA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14841.11 Da Isoelectric Point: 7.9466
>T293160 WP_064130873.1 NZ_LT571436:1852048-1852449 [Neisseria weaveri]
MLRYMLDTNICIYTIKNNPAAVREKFQQHQHHMCISSIVLTELLYGAEKSSNPAKSLALVEGMAARLEVLNFDETAAAHA
AEIRADLTRKGTPIGHYDVLIAGHARSRGLILVSNNLREFERVAGLRLENWAV
MLRYMLDTNICIYTIKNNPAAVREKFQQHQHHMCISSIVLTELLYGAEKSSNPAKSLALVEGMAARLEVLNFDETAAAHA
AEIRADLTRKGTPIGHYDVLIAGHARSRGLILVSNNLREFERVAGLRLENWAV
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|