Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 3336629..3337448 | Replicon | chromosome |
Accession | NZ_LT556085 | ||
Organism | Citrobacter amalonaticus strain 92 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | A0A3S5G4N2 |
Locus tag | CITRO92_RS16510 | Protein ID | WP_043001077.1 |
Coordinates | 3336629..3336886 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | CITRO92_RS16515 | Protein ID | WP_044258114.1 |
Coordinates | 3336897..3337448 (+) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CITRO92_RS16475 | 3332434..3333339 | - | 906 | WP_043001082.1 | dihydrodipicolinate synthase family protein | - |
CITRO92_RS16480 | 3333344..3334132 | - | 789 | WP_043001081.1 | IclR family transcriptional regulator | - |
CITRO92_RS16485 | 3334368..3335159 | + | 792 | WP_109740146.1 | PhzF family phenazine biosynthesis protein | - |
CITRO92_RS16495 | 3335641..3336033 | + | 393 | WP_044258118.1 | VOC family protein | - |
CITRO92_RS16500 | 3336043..3336249 | + | 207 | WP_044258115.1 | tryptophan synthase subunit alpha | - |
CITRO92_RS16510 | 3336629..3336886 | + | 258 | WP_043001077.1 | YjhX family toxin | Toxin |
CITRO92_RS16515 | 3336897..3337448 | + | 552 | WP_044258114.1 | N-acetyltransferase | Antitoxin |
CITRO92_RS16520 | 3337500..3338246 | + | 747 | WP_061070267.1 | class I SAM-dependent methyltransferase | - |
CITRO92_RS16525 | 3338923..3339507 | + | 585 | WP_044264020.1 | hypothetical protein | - |
CITRO92_RS16530 | 3339817..3340941 | - | 1125 | WP_109740148.1 | N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9490.00 Da Isoelectric Point: 11.1381
>T293154 WP_043001077.1 NZ_LT556085:3336629-3336886 [Citrobacter amalonaticus]
MNLSRQEQRTLHVLAKGGRIAHVRDASGRVTAVECYSREGLLLADCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QPDNR
MNLSRQEQRTLHVLAKGGRIAHVRDASGRVTAVECYSREGLLLADCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QPDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20365.25 Da Isoelectric Point: 6.0668
>AT293154 WP_044258114.1 NZ_LT556085:3336897-3337448 [Citrobacter amalonaticus]
MTTRNFTIHITDESDTNDIREVETRAFGYSKEACLVASLLEDDTARPTLSLLARQEGNAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGRGVGGLLIRTGIEHLRSMGCQCVFVLGHATYYPRHGFEPCAGDKGFPAPYPIAEEHKACWMMQSLSA
QPFDRAGDIQCAQALMKPEHWRE
MTTRNFTIHITDESDTNDIREVETRAFGYSKEACLVASLLEDDTARPTLSLLARQEGNAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGRGVGGLLIRTGIEHLRSMGCQCVFVLGHATYYPRHGFEPCAGDKGFPAPYPIAEEHKACWMMQSLSA
QPFDRAGDIQCAQALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|