Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2692165..2692785 | Replicon | chromosome |
| Accession | NZ_LT556085 | ||
| Organism | Citrobacter amalonaticus strain 92 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | CITRO92_RS13330 | Protein ID | WP_001280991.1 |
| Coordinates | 2692165..2692383 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A3Q8DH98 |
| Locus tag | CITRO92_RS13335 | Protein ID | WP_042324455.1 |
| Coordinates | 2692411..2692785 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CITRO92_RS13300 | 2687818..2688414 | + | 597 | WP_044258943.1 | membrane protein | - |
| CITRO92_RS13305 | 2688497..2688850 | + | 354 | WP_043001561.1 | DUF1428 family protein | - |
| CITRO92_RS13310 | 2688890..2690440 | - | 1551 | WP_109739954.1 | EAL domain-containing protein | - |
| CITRO92_RS13315 | 2690663..2690803 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| CITRO92_RS13320 | 2690853..2691323 | - | 471 | WP_043001559.1 | YlaC family protein | - |
| CITRO92_RS13325 | 2691437..2691988 | - | 552 | WP_044258934.1 | maltose O-acetyltransferase | - |
| CITRO92_RS13330 | 2692165..2692383 | - | 219 | WP_001280991.1 | hemolysin expression modulator Hha | Toxin |
| CITRO92_RS13335 | 2692411..2692785 | - | 375 | WP_042324455.1 | Hha toxicity modulator TomB | Antitoxin |
| CITRO92_RS13340 | 2693296..2696445 | - | 3150 | WP_043001557.1 | multidrug efflux RND transporter permease subunit | - |
| CITRO92_RS13345 | 2696468..2697661 | - | 1194 | WP_043001556.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T293153 WP_001280991.1 NZ_LT556085:c2692383-2692165 [Citrobacter amalonaticus]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14495.31 Da Isoelectric Point: 4.8989
>AT293153 WP_042324455.1 NZ_LT556085:c2692785-2692411 [Citrobacter amalonaticus]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|