Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeV-yfjZ/CbtA-CbeA |
| Location | 2503268..2504007 | Replicon | chromosome |
| Accession | NZ_LT556085 | ||
| Organism | Citrobacter amalonaticus strain 92 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | CITRO92_RS12480 | Protein ID | WP_109739897.1 |
| Coordinates | 2503268..2503633 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | CITRO92_RS12485 | Protein ID | WP_109739898.1 |
| Coordinates | 2503669..2504007 (-) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CITRO92_RS12445 | 2498592..2499026 | + | 435 | WP_023303144.1 | hypothetical protein | - |
| CITRO92_RS12450 | 2499085..2499924 | + | 840 | WP_023303145.1 | hypothetical protein | - |
| CITRO92_RS12460 | 2500614..2501435 | + | 822 | WP_023303146.1 | DUF945 domain-containing protein | - |
| CITRO92_RS12465 | 2501501..2501971 | + | 471 | WP_023303147.1 | DNA repair protein RadC | - |
| CITRO92_RS12470 | 2501984..2502310 | + | 327 | WP_023303148.1 | type IV toxin-antitoxin system YeeU family antitoxin | - |
| CITRO92_RS12475 | 2502331..2502699 | + | 369 | WP_023303149.1 | TA system toxin CbtA family protein | - |
| CITRO92_RS12480 | 2503268..2503633 | - | 366 | WP_109739897.1 | TA system toxin CbtA family protein | Toxin |
| CITRO92_RS12485 | 2503669..2504007 | - | 339 | WP_109739898.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| CITRO92_RS12490 | 2504023..2504244 | - | 222 | WP_109739899.1 | DUF987 family protein | - |
| CITRO92_RS12495 | 2504241..2504741 | - | 501 | WP_174217526.1 | DNA repair protein RadC | - |
| CITRO92_RS12500 | 2504771..2505589 | - | 819 | WP_109739900.1 | DUF945 domain-containing protein | - |
| CITRO92_RS12505 | 2505689..2506366 | - | 678 | WP_109739901.1 | hypothetical protein | - |
| CITRO92_RS12510 | 2506653..2507546 | - | 894 | WP_109739902.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2498592..2520889 | 22297 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13623.75 Da Isoelectric Point: 10.6168
>T293152 WP_109739897.1 NZ_LT556085:c2503633-2503268 [Citrobacter amalonaticus]
MQISTAPTTVPVSSRLTPIEVWQILLKHLLAQHYGLTLNDTPFSDESTIRQHINAGISLSNAVNFIVEKYELVRTDRSRF
TIMAQSPFISSIEILRARRATGLMKRQGYKSISNITTGHLL
MQISTAPTTVPVSSRLTPIEVWQILLKHLLAQHYGLTLNDTPFSDESTIRQHINAGISLSNAVNFIVEKYELVRTDRSRF
TIMAQSPFISSIEILRARRATGLMKRQGYKSISNITTGHLL
Download Length: 366 bp
Antitoxin
Download Length: 113 a.a. Molecular weight: 12479.25 Da Isoelectric Point: 7.2412
>AT293152 WP_109739898.1 NZ_LT556085:c2504007-2503669 [Citrobacter amalonaticus]
MTKEPVQEHVWGLHSQTVPSFSARLVQEGRRLHFLADRATLLGTFSPEQSATLDAIFPALIRGMETALLSGKLDPRKAKQ
YIYIRNGFACESDTLGSCGYVYIVIYPQSETS
MTKEPVQEHVWGLHSQTVPSFSARLVQEGRRLHFLADRATLLGTFSPEQSATLDAIFPALIRGMETALLSGKLDPRKAKQ
YIYIRNGFACESDTLGSCGYVYIVIYPQSETS
Download Length: 339 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|