Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yfjZ-ypjF/CbtA-CbeA
Location 2501984..2502699 Replicon chromosome
Accession NZ_LT556085
Organism Citrobacter amalonaticus strain 92

Toxin (Protein)


Gene name ypjF Uniprot ID A0A8I0UM05
Locus tag CITRO92_RS12475 Protein ID WP_023303149.1
Coordinates 2502331..2502699 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID A0A8I0UJV2
Locus tag CITRO92_RS12470 Protein ID WP_023303148.1
Coordinates 2501984..2502310 (+) Length 109 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CITRO92_RS12440 2497018..2498283 + 1266 WP_023303143.1 hypothetical protein -
CITRO92_RS12445 2498592..2499026 + 435 WP_023303144.1 hypothetical protein -
CITRO92_RS12450 2499085..2499924 + 840 WP_023303145.1 hypothetical protein -
CITRO92_RS12460 2500614..2501435 + 822 WP_023303146.1 DUF945 domain-containing protein -
CITRO92_RS12465 2501501..2501971 + 471 WP_023303147.1 DNA repair protein RadC -
CITRO92_RS12470 2501984..2502310 + 327 WP_023303148.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
CITRO92_RS12475 2502331..2502699 + 369 WP_023303149.1 TA system toxin CbtA family protein Toxin
CITRO92_RS12480 2503268..2503633 - 366 WP_109739897.1 TA system toxin CbtA family protein -
CITRO92_RS12485 2503669..2504007 - 339 WP_109739898.1 type IV toxin-antitoxin system YeeU family antitoxin -
CITRO92_RS12490 2504023..2504244 - 222 WP_109739899.1 DUF987 family protein -
CITRO92_RS12495 2504241..2504741 - 501 WP_174217526.1 DNA repair protein RadC -
CITRO92_RS12500 2504771..2505589 - 819 WP_109739900.1 DUF945 domain-containing protein -
CITRO92_RS12505 2505689..2506366 - 678 WP_109739901.1 hypothetical protein -
CITRO92_RS12510 2506653..2507546 - 894 WP_109739902.1 50S ribosome-binding GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2498592..2520889 22297


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-111)

Antitoxin

Antitoxin CbeA

(7-107)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13727.91 Da        Isoelectric Point: 8.2822

>T293151 WP_023303149.1 NZ_LT556085:2502331-2502699 [Citrobacter amalonaticus]
MKNLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIILADAVNFLVDKYELVRIDRRGF
SSQGQVPYLTVTDILHARRACGLMKSCSYREVSNIVLSHSRQ

Download         Length: 369 bp

Antitoxin


Download         Length: 109 a.a.        Molecular weight: 12215.04 Da        Isoelectric Point: 7.0266

>AT293151 WP_023303148.1 NZ_LT556085:2501984-2502310 [Citrobacter amalonaticus]
MSLIPAHEWGIKSDIVPRLGVRLVQEGNRLHYLADRASITGKFSDAECLKLDIVFPHFIRQMESMLTTGEMNSRHAHCVT
LYHNGFTCEADTLGSCGYVYIAIYPTQR

Download         Length: 327 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References