Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 1026301..1026926 | Replicon | chromosome |
| Accession | NZ_LT556085 | ||
| Organism | Citrobacter amalonaticus strain 92 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A381GI10 |
| Locus tag | CITRO92_RS05050 | Protein ID | WP_042998865.1 |
| Coordinates | 1026301..1026687 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | CITRO92_RS05055 | Protein ID | WP_162300700.1 |
| Coordinates | 1026687..1026926 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CITRO92_RS05030 | 1021654..1022991 | + | 1338 | WP_086512772.1 | VWA domain-containing protein | - |
| CITRO92_RS05035 | 1023009..1024505 | + | 1497 | WP_109739661.1 | HAMP domain-containing histidine kinase | - |
| CITRO92_RS05040 | 1024510..1025196 | + | 687 | WP_044257174.1 | response regulator transcription factor | - |
| CITRO92_RS05045 | 1025341..1026270 | + | 930 | WP_042998866.1 | formate dehydrogenase accessory protein FdhE | - |
| CITRO92_RS05050 | 1026301..1026687 | - | 387 | WP_042998865.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| CITRO92_RS05055 | 1026687..1026926 | - | 240 | WP_162300700.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| CITRO92_RS05060 | 1027136..1028062 | + | 927 | WP_061069448.1 | alpha/beta hydrolase | - |
| CITRO92_RS05065 | 1028078..1029019 | - | 942 | WP_042998862.1 | fatty acid biosynthesis protein FabY | - |
| CITRO92_RS05070 | 1029064..1029501 | - | 438 | WP_044265155.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| CITRO92_RS05075 | 1029498..1030370 | - | 873 | WP_044257165.1 | virulence factor BrkB family protein | - |
| CITRO92_RS05080 | 1030364..1030963 | - | 600 | WP_044265152.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14404.65 Da Isoelectric Point: 9.4114
>T293149 WP_042998865.1 NZ_LT556085:c1026687-1026301 [Citrobacter amalonaticus]
MQKGPVLFDTNILIDLFSGRQEAQQVLEAYPPQNAISLVTWMEVMVGAKKYHQEYRTRVALSAFNIIGVSQEIAERSVNL
RQEYGMKLPDAIILATAQIHRFALVTRNTRDFAGIPGVITPYQLQAGR
MQKGPVLFDTNILIDLFSGRQEAQQVLEAYPPQNAISLVTWMEVMVGAKKYHQEYRTRVALSAFNIIGVSQEIAERSVNL
RQEYGMKLPDAIILATAQIHRFALVTRNTRDFAGIPGVITPYQLQAGR
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|