Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 462049..462728 | Replicon | chromosome |
| Accession | NZ_LT556085 | ||
| Organism | Citrobacter amalonaticus strain 92 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | CITRO92_RS02240 | Protein ID | WP_109739503.1 |
| Coordinates | 462049..462390 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | CITRO92_RS02245 | Protein ID | WP_109739504.1 |
| Coordinates | 462411..462728 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CITRO92_RS02210 | 457779..458654 | + | 876 | WP_000774153.1 | 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase | - |
| CITRO92_RS02215 | 458703..458993 | + | 291 | WP_044264508.1 | (4S)-4-hydroxy-5-phosphonooxypentane-2,3-dione isomerase | - |
| CITRO92_RS02220 | 459004..459750 | + | 747 | WP_109739500.1 | epimerase | - |
| CITRO92_RS02230 | 460070..460867 | - | 798 | WP_109739501.1 | helix-turn-helix transcriptional regulator | - |
| CITRO92_RS02235 | 461100..461933 | - | 834 | WP_109739502.1 | DUF4942 domain-containing protein | - |
| CITRO92_RS02240 | 462049..462390 | - | 342 | WP_109739503.1 | TA system toxin CbtA family protein | Toxin |
| CITRO92_RS02245 | 462411..462728 | - | 318 | WP_109739504.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| CITRO92_RS02250 | 462747..462968 | - | 222 | WP_109739505.1 | DUF987 domain-containing protein | - |
| CITRO92_RS02255 | 462977..463453 | - | 477 | WP_109739506.1 | RadC family protein | - |
| CITRO92_RS02260 | 463469..463927 | - | 459 | WP_109739507.1 | antirestriction protein | - |
| CITRO92_RS02265 | 464024..464263 | - | 240 | WP_109739508.1 | DUF905 domain-containing protein | - |
| CITRO92_RS02270 | 464341..464814 | - | 474 | WP_109739509.1 | hypothetical protein | - |
| CITRO92_RS02275 | 464836..465675 | - | 840 | WP_109739510.1 | hypothetical protein | - |
| CITRO92_RS02280 | 465714..466415 | - | 702 | WP_109739511.1 | WYL domain-containing protein | - |
| CITRO92_RS02285 | 466632..467453 | - | 822 | WP_109739512.1 | DUF945 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 460070..481237 | 21167 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12885.04 Da Isoelectric Point: 9.9572
>T293147 WP_109739503.1 NZ_LT556085:c462390-462049 [Citrobacter amalonaticus]
MKILPATISRAAKPCLPPVAVWQMLLTRLLEKHYGLTLNDTPFSDEIVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNAVR
MKILPATISRAAKPCLPPVAVWQMLLTRLLEKHYGLTLNDTPFSDEIVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|