Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4954343..4955097 Replicon chromosome
Accession NZ_LT556084
Organism Citrobacter amalonaticus strain 86

Toxin (Protein)


Gene name yeeV Uniprot ID A0A6L5EGB6
Locus tag CITRO86_RS24525 Protein ID WP_032669201.1
Coordinates 4954343..4954720 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag CITRO86_RS24530 Protein ID WP_074143921.1
Coordinates 4954771..4955097 (-) Length 109 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CITRO86_RS24495 4950009..4951853 + 1845 WP_042998197.1 RNA polymerase sigma factor RpoD -
CITRO86_RS24500 4951900..4952406 - 507 WP_109739821.1 G/U mismatch-specific DNA glycosylase -
CITRO86_RS24510 4952710..4953558 - 849 WP_032669204.1 DUF4942 domain-containing protein -
CITRO86_RS24515 4953622..4953825 - 204 WP_032669203.1 DUF957 domain-containing protein -
CITRO86_RS24520 4953855..4954346 - 492 WP_032672023.1 hypothetical protein -
CITRO86_RS24525 4954343..4954720 - 378 WP_032669201.1 TA system toxin CbtA family protein Toxin
CITRO86_RS24530 4954771..4955097 - 327 WP_074143921.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
CITRO86_RS24535 4955154..4955375 - 222 WP_023567997.1 DUF987 domain-containing protein -
CITRO86_RS24540 4955396..4955875 - 480 WP_032669200.1 DNA repair protein RadC -
CITRO86_RS24545 4955887..4956330 - 444 WP_032669199.1 antirestriction protein -
CITRO86_RS24550 4956361..4957182 - 822 WP_032669198.1 DUF945 domain-containing protein -
CITRO86_RS24555 4957281..4957512 - 232 Protein_4624 DUF905 domain-containing protein -
CITRO86_RS24560 4957584..4958033 - 450 WP_032669197.1 hypothetical protein -
CITRO86_RS24565 4958030..4958485 - 456 WP_000754598.1 hypothetical protein -
CITRO86_RS24570 4958524..4959159 - 636 WP_020837117.1 hypothetical protein -
CITRO86_RS24575 4959156..4959869 - 714 WP_032669194.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(4-103)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14157.93 Da        Isoelectric Point: 6.2236

>T293145 WP_032669201.1 NZ_LT556084:c4954720-4954343 [Citrobacter amalonaticus]
MQTQPLSSTQEATPRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRTDRRGF
NAETQSPLLSSIDILRARKATGLMTRNDYRTVTDITTGKYREVQP

Download         Length: 378 bp

Antitoxin


Download         Length: 109 a.a.        Molecular weight: 11953.71 Da        Isoelectric Point: 6.8397

>AT293145 WP_074143921.1 NZ_LT556084:c4955097-4954771 [Citrobacter amalonaticus]
ITEPWWGLKRSITPCFGARLVQAGNRLHYLADRANITGQFSDADLRYLDQAFPLLLKQLELMLTSGELNPCHQHCVTLYA
KGLTCEADSLGSHGYVYLAIYPTPAATA

Download         Length: 327 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6L5EGB6

Antitoxin

Source ID Structure

References