Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yfjZ-ypjF/CbtA-CbeA
Location 4385164..4385879 Replicon chromosome
Accession NZ_LT556084
Organism Citrobacter amalonaticus strain 86

Toxin (Protein)


Gene name ypjF Uniprot ID A0A8I0UM05
Locus tag CITRO86_RS21660 Protein ID WP_023303149.1
Coordinates 4385164..4385532 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID A0A8I0UJV2
Locus tag CITRO86_RS21665 Protein ID WP_023303148.1
Coordinates 4385553..4385879 (-) Length 109 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CITRO86_RS21625 4380317..4381210 + 894 WP_109739902.1 50S ribosome-binding GTPase -
CITRO86_RS21630 4381497..4382174 + 678 WP_109739901.1 hypothetical protein -
CITRO86_RS21635 4382274..4383092 + 819 WP_109739900.1 DUF945 domain-containing protein -
CITRO86_RS21640 4383122..4383622 + 501 WP_174217526.1 DNA repair protein RadC -
CITRO86_RS21645 4383619..4383840 + 222 WP_109739899.1 DUF987 family protein -
CITRO86_RS21650 4383856..4384194 + 339 WP_109739898.1 type IV toxin-antitoxin system YeeU family antitoxin -
CITRO86_RS21655 4384230..4384595 + 366 WP_109739897.1 TA system toxin CbtA family protein -
CITRO86_RS21660 4385164..4385532 - 369 WP_023303149.1 TA system toxin CbtA family protein Toxin
CITRO86_RS21665 4385553..4385879 - 327 WP_023303148.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
CITRO86_RS21670 4385892..4386362 - 471 WP_023303147.1 DNA repair protein RadC -
CITRO86_RS21675 4386428..4387249 - 822 WP_023303146.1 DUF945 domain-containing protein -
CITRO86_RS21685 4387939..4388778 - 840 WP_023303145.1 hypothetical protein -
CITRO86_RS21690 4388837..4389271 - 435 WP_023303144.1 hypothetical protein -
CITRO86_RS21695 4389580..4390845 - 1266 WP_023303143.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4368848..4406797 37949


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-111)

Antitoxin

Antitoxin CbeA

(7-107)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13727.91 Da        Isoelectric Point: 8.2822

>T293144 WP_023303149.1 NZ_LT556084:c4385532-4385164 [Citrobacter amalonaticus]
MKNLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIILADAVNFLVDKYELVRIDRRGF
SSQGQVPYLTVTDILHARRACGLMKSCSYREVSNIVLSHSRQ

Download         Length: 369 bp

Antitoxin


Download         Length: 109 a.a.        Molecular weight: 12215.04 Da        Isoelectric Point: 7.0266

>AT293144 WP_023303148.1 NZ_LT556084:c4385879-4385553 [Citrobacter amalonaticus]
MSLIPAHEWGIKSDIVPRLGVRLVQEGNRLHYLADRASITGKFSDAECLKLDIVFPHFIRQMESMLTTGEMNSRHAHCVT
LYHNGFTCEADTLGSCGYVYIAIYPTQR

Download         Length: 327 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References