Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 4385164..4385879 | Replicon | chromosome |
| Accession | NZ_LT556084 | ||
| Organism | Citrobacter amalonaticus strain 86 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A8I0UM05 |
| Locus tag | CITRO86_RS21660 | Protein ID | WP_023303149.1 |
| Coordinates | 4385164..4385532 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A8I0UJV2 |
| Locus tag | CITRO86_RS21665 | Protein ID | WP_023303148.1 |
| Coordinates | 4385553..4385879 (-) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CITRO86_RS21625 | 4380317..4381210 | + | 894 | WP_109739902.1 | 50S ribosome-binding GTPase | - |
| CITRO86_RS21630 | 4381497..4382174 | + | 678 | WP_109739901.1 | hypothetical protein | - |
| CITRO86_RS21635 | 4382274..4383092 | + | 819 | WP_109739900.1 | DUF945 domain-containing protein | - |
| CITRO86_RS21640 | 4383122..4383622 | + | 501 | WP_174217526.1 | DNA repair protein RadC | - |
| CITRO86_RS21645 | 4383619..4383840 | + | 222 | WP_109739899.1 | DUF987 family protein | - |
| CITRO86_RS21650 | 4383856..4384194 | + | 339 | WP_109739898.1 | type IV toxin-antitoxin system YeeU family antitoxin | - |
| CITRO86_RS21655 | 4384230..4384595 | + | 366 | WP_109739897.1 | TA system toxin CbtA family protein | - |
| CITRO86_RS21660 | 4385164..4385532 | - | 369 | WP_023303149.1 | TA system toxin CbtA family protein | Toxin |
| CITRO86_RS21665 | 4385553..4385879 | - | 327 | WP_023303148.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| CITRO86_RS21670 | 4385892..4386362 | - | 471 | WP_023303147.1 | DNA repair protein RadC | - |
| CITRO86_RS21675 | 4386428..4387249 | - | 822 | WP_023303146.1 | DUF945 domain-containing protein | - |
| CITRO86_RS21685 | 4387939..4388778 | - | 840 | WP_023303145.1 | hypothetical protein | - |
| CITRO86_RS21690 | 4388837..4389271 | - | 435 | WP_023303144.1 | hypothetical protein | - |
| CITRO86_RS21695 | 4389580..4390845 | - | 1266 | WP_023303143.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4368848..4406797 | 37949 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13727.91 Da Isoelectric Point: 8.2822
>T293144 WP_023303149.1 NZ_LT556084:c4385532-4385164 [Citrobacter amalonaticus]
MKNLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIILADAVNFLVDKYELVRIDRRGF
SSQGQVPYLTVTDILHARRACGLMKSCSYREVSNIVLSHSRQ
MKNLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIILADAVNFLVDKYELVRIDRRGF
SSQGQVPYLTVTDILHARRACGLMKSCSYREVSNIVLSHSRQ
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|