Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 3591475..3592294 | Replicon | chromosome |
Accession | NZ_LT556084 | ||
Organism | Citrobacter amalonaticus strain 86 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | A0A3S5G4N2 |
Locus tag | CITRO86_RS17950 | Protein ID | WP_043001077.1 |
Coordinates | 3592037..3592294 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | CITRO86_RS17945 | Protein ID | WP_044258114.1 |
Coordinates | 3591475..3592026 (-) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CITRO86_RS17930 | 3587982..3589106 | + | 1125 | WP_109740148.1 | N-acetyltransferase | - |
CITRO86_RS17935 | 3589416..3590000 | - | 585 | WP_044264020.1 | hypothetical protein | - |
CITRO86_RS17940 | 3590677..3591423 | - | 747 | WP_061070267.1 | class I SAM-dependent methyltransferase | - |
CITRO86_RS17945 | 3591475..3592026 | - | 552 | WP_044258114.1 | N-acetyltransferase | Antitoxin |
CITRO86_RS17950 | 3592037..3592294 | - | 258 | WP_043001077.1 | YjhX family toxin | Toxin |
CITRO86_RS17960 | 3592674..3592880 | - | 207 | WP_044258115.1 | tryptophan synthase subunit alpha | - |
CITRO86_RS17965 | 3592890..3593282 | - | 393 | WP_044258118.1 | VOC family protein | - |
CITRO86_RS17975 | 3593764..3594555 | - | 792 | WP_109740146.1 | PhzF family phenazine biosynthesis protein | - |
CITRO86_RS17980 | 3594791..3595579 | + | 789 | WP_043001081.1 | IclR family transcriptional regulator | - |
CITRO86_RS17985 | 3595584..3596489 | + | 906 | WP_043001082.1 | dihydrodipicolinate synthase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9490.00 Da Isoelectric Point: 11.1381
>T293141 WP_043001077.1 NZ_LT556084:c3592294-3592037 [Citrobacter amalonaticus]
MNLSRQEQRTLHVLAKGGRIAHVRDASGRVTAVECYSREGLLLADCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QPDNR
MNLSRQEQRTLHVLAKGGRIAHVRDASGRVTAVECYSREGLLLADCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QPDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20365.25 Da Isoelectric Point: 6.0668
>AT293141 WP_044258114.1 NZ_LT556084:c3592026-3591475 [Citrobacter amalonaticus]
MTTRNFTIHITDESDTNDIREVETRAFGYSKEACLVASLLEDDTARPTLSLLARQEGNAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGRGVGGLLIRTGIEHLRSMGCQCVFVLGHATYYPRHGFEPCAGDKGFPAPYPIAEEHKACWMMQSLSA
QPFDRAGDIQCAQALMKPEHWRE
MTTRNFTIHITDESDTNDIREVETRAFGYSKEACLVASLLEDDTARPTLSLLARQEGNAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGRGVGGLLIRTGIEHLRSMGCQCVFVLGHATYYPRHGFEPCAGDKGFPAPYPIAEEHKACWMMQSLSA
QPFDRAGDIQCAQALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|