Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 822685..823310 | Replicon | chromosome |
| Accession | NZ_LT556084 | ||
| Organism | Citrobacter amalonaticus strain 86 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A381GI10 |
| Locus tag | CITRO86_RS04085 | Protein ID | WP_042998865.1 |
| Coordinates | 822924..823310 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | CITRO86_RS04080 | Protein ID | WP_162300700.1 |
| Coordinates | 822685..822924 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CITRO86_RS04055 | 818648..819247 | + | 600 | WP_044265152.1 | glucose-1-phosphatase | - |
| CITRO86_RS04060 | 819241..820113 | + | 873 | WP_044257165.1 | virulence factor BrkB family protein | - |
| CITRO86_RS04065 | 820110..820547 | + | 438 | WP_044265155.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| CITRO86_RS04070 | 820592..821533 | + | 942 | WP_042998862.1 | fatty acid biosynthesis protein FabY | - |
| CITRO86_RS04075 | 821549..822475 | - | 927 | WP_061069448.1 | alpha/beta hydrolase | - |
| CITRO86_RS04080 | 822685..822924 | + | 240 | WP_162300700.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| CITRO86_RS04085 | 822924..823310 | + | 387 | WP_042998865.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| CITRO86_RS04090 | 823341..824270 | - | 930 | WP_042998866.1 | formate dehydrogenase accessory protein FdhE | - |
| CITRO86_RS04095 | 824415..825101 | - | 687 | WP_044257174.1 | response regulator transcription factor | - |
| CITRO86_RS04100 | 825106..826602 | - | 1497 | WP_109739661.1 | HAMP domain-containing histidine kinase | - |
| CITRO86_RS04105 | 826620..827957 | - | 1338 | WP_086512772.1 | VWA domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14404.65 Da Isoelectric Point: 9.4114
>T293132 WP_042998865.1 NZ_LT556084:822924-823310 [Citrobacter amalonaticus]
MQKGPVLFDTNILIDLFSGRQEAQQVLEAYPPQNAISLVTWMEVMVGAKKYHQEYRTRVALSAFNIIGVSQEIAERSVNL
RQEYGMKLPDAIILATAQIHRFALVTRNTRDFAGIPGVITPYQLQAGR
MQKGPVLFDTNILIDLFSGRQEAQQVLEAYPPQNAISLVTWMEVMVGAKKYHQEYRTRVALSAFNIIGVSQEIAERSVNL
RQEYGMKLPDAIILATAQIHRFALVTRNTRDFAGIPGVITPYQLQAGR
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|