Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-AbrB |
| Location | 1668141..1668788 | Replicon | chromosome |
| Accession | NZ_LT549890 | ||
| Organism | Saccharolobus solfataricus strain P1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | SSOP1_RS08900 | Protein ID | WP_009990357.1 |
| Coordinates | 1668141..1668413 (-) | Length | 91 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0E3K976 |
| Locus tag | SSOP1_RS08905 | Protein ID | WP_009990356.1 |
| Coordinates | 1668528..1668788 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SSOP1_RS08885 (SSOP1_1867) | 1663402..1664453 | - | 1052 | Protein_1778 | ISH3 family transposase | - |
| SSOP1_RS08895 (SSOP1_1870) | 1666671..1667618 | - | 948 | WP_009990359.1 | ATP/GTP-binding protein | - |
| SSOP1_RS08900 (SSOP1_1871) | 1668141..1668413 | - | 273 | WP_009990357.1 | PIN domain-containing protein | Toxin |
| SSOP1_RS08905 (SSOP1_1872) | 1668528..1668788 | - | 261 | WP_009990356.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| SSOP1_RS08910 (SSOP1_1873) | 1669059..1670024 | - | 966 | WP_010923029.1 | ISH3-like element ISC1439A family transposase | - |
| SSOP1_RS17095 | 1670923..1671084 | + | 162 | WP_009990355.1 | hypothetical protein | - |
| SSOP1_RS08920 (SSOP1_1874) | 1671186..1671644 | + | 459 | WP_009990354.1 | hypothetical protein | - |
| SSOP1_RS08925 (SSOP1_1875) | 1672393..1672899 | - | 507 | WP_014511696.1 | thiosulfate:quinone oxidoreductase small subunit | - |
| SSOP1_RS08930 (SSOP1_1876) | 1672905..1673447 | - | 543 | WP_009990352.1 | thiosulfate:quinone oxidoreductase large subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1660998..1678149 | 17151 | |
| - | inside | IScluster/Tn | - | - | 1660998..1678702 | 17704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10475.34 Da Isoelectric Point: 9.7534
>T293128 WP_009990357.1 NZ_LT549890:c1668413-1668141 [Saccharolobus solfataricus]
MRLFTLSKKKYNVKFEDTIDFLDKIILPYTIILPINSHDYEKAKGIMISKTLKPSDAFHVAVMINNSIKKIVSEDSDFDK
INGIERIWVK
MRLFTLSKKKYNVKFEDTIDFLDKIILPYTIILPINSHDYEKAKGIMISKTLKPSDAFHVAVMINNSIKKIVSEDSDFDK
INGIERIWVK
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|