Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1447837..1448443 | Replicon | chromosome |
| Accession | NZ_LT549890 | ||
| Organism | Saccharolobus solfataricus strain P1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | SSOP1_RS07845 | Protein ID | WP_231918326.1 |
| Coordinates | 1448108..1448443 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | SSOP1_RS07840 | Protein ID | WP_029552585.1 |
| Coordinates | 1447837..1448058 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SSOP1_RS07815 (SSOP1_1615) | 1443525..1444781 | - | 1257 | WP_014511659.1 | RNA-guided endonuclease TnpB family protein | - |
| SSOP1_RS07820 | 1444759..1445302 | - | 544 | Protein_1559 | IS607 family transposase | - |
| SSOP1_RS16360 | 1445630..1446297 | + | 668 | Protein_1560 | ISNCY family transposase | - |
| SSOP1_RS07835 (SSOP1_1620) | 1446706..1447278 | - | 573 | WP_010923431.1 | metallophosphoesterase | - |
| SSOP1_RS07840 (SSOP1_1621) | 1447837..1448058 | + | 222 | WP_029552585.1 | hypothetical protein | Antitoxin |
| SSOP1_RS07845 (SSOP1_1622) | 1448108..1448443 | + | 336 | WP_231918326.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| SSOP1_RS07850 (SSOP1_1623) | 1448651..1449766 | + | 1116 | WP_009991657.1 | hypothetical protein | - |
| SSOP1_RS07855 (SSOP1_1624) | 1449910..1450245 | - | 336 | Protein_1565 | transposase | - |
| SSOP1_RS17015 | 1450427..1450572 | - | 146 | Protein_1566 | IS630 family transposase | - |
| SSOP1_RS07865 (SSOP1_1625) | 1450968..1451465 | - | 498 | WP_014511660.1 | hypothetical protein | - |
| SSOP1_RS07870 (SSOP1_1627) | 1451607..1452580 | - | 974 | Protein_1568 | IS5 family transposase | - |
| SSOP1_RS07875 | 1452705..1453043 | + | 339 | WP_010923427.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 1443525..1456222 | 12697 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12427.61 Da Isoelectric Point: 5.2389
>T293127 WP_231918326.1 NZ_LT549890:1448108-1448443 [Saccharolobus solfataricus]
IREILKDAETLDFALVEVSNVVWKKAVLTGELTGKDVIKAITIVKEYLPQLLTVNKSIDLIERAIEISVNEKITVYDSLY
IALAECKGSKLVTGDKKQYDVAKKYVISELI
IREILKDAETLDFALVEVSNVVWKKAVLTGELTGKDVIKAITIVKEYLPQLLTVNKSIDLIERAIEISVNEKITVYDSLY
IALAECKGSKLVTGDKKQYDVAKKYVISELI
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|