Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-AbrB |
| Location | 1432611..1433211 | Replicon | chromosome |
| Accession | NZ_LT549890 | ||
| Organism | Saccharolobus solfataricus strain P1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | SSOP1_RS07775 | Protein ID | WP_048054229.1 |
| Coordinates | 1432822..1433211 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A157T1M9 |
| Locus tag | SSOP1_RS07770 | Protein ID | WP_048054328.1 |
| Coordinates | 1432611..1432835 (+) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SSOP1_RS07745 (SSOP1_1600) | 1428679..1429122 | - | 444 | WP_010923418.1 | hypothetical protein | - |
| SSOP1_RS07750 (SSOP1_1601) | 1429206..1429634 | - | 429 | WP_010923419.1 | transposase | - |
| SSOP1_RS17635 | 1429702..1429872 | + | 171 | Protein_1545 | transposase | - |
| SSOP1_RS07755 (SSOP1_1602) | 1429847..1430743 | - | 897 | Protein_1546 | ISH3-like element ISC1225 family transposase | - |
| SSOP1_RS07760 (SSOP1_1603) | 1430916..1431875 | - | 960 | WP_010923364.1 | IS5-like element ISC1234 family transposase | - |
| SSOP1_RS07765 (SSOP1_1604) | 1431973..1432137 | - | 165 | Protein_1548 | DUF4322 domain-containing protein | - |
| SSOP1_RS07770 (SSOP1_1605) | 1432611..1432835 | + | 225 | WP_048054328.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| SSOP1_RS07775 (SSOP1_1606) | 1432822..1433211 | + | 390 | WP_048054229.1 | PIN domain-containing protein | Toxin |
| SSOP1_RS17005 | 1433652..1433819 | - | 168 | WP_158011701.1 | hypothetical protein | - |
| SSOP1_RS17010 (SSOP1_1608) | 1433902..1434366 | - | 465 | WP_231918247.1 | hypothetical protein | - |
| SSOP1_RS07790 (SSOP1_1609) | 1434506..1435771 | - | 1266 | WP_010923438.1 | MFS transporter | - |
| SSOP1_RS07795 (SSOP1_1610) | 1436818..1437993 | + | 1176 | WP_010923437.1 | RNA-guided endonuclease TnpB family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 1425258..1437993 | 12735 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14446.03 Da Isoelectric Point: 4.5625
>T293126 WP_048054229.1 NZ_LT549890:1432822-1433211 [Saccharolobus solfataricus]
MIVVDTNVLIYATLEDSEFHTQSLEIIEGSDIIVPQIVVFEYIKVLSEIVQNLDFIKTKISELNNFVVVCEDLNTIALAL
RLLAELKLSLKDINDMIILTAAIKTNSSIATFDQKLRKIADKKGVKVLP
MIVVDTNVLIYATLEDSEFHTQSLEIIEGSDIIVPQIVVFEYIKVLSEIVQNLDFIKTKISELNNFVVVCEDLNTIALAL
RLLAELKLSLKDINDMIILTAAIKTNSSIATFDQKLRKIADKKGVKVLP
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|