Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-AbrB |
| Location | 1432611..1433211 | Replicon | chromosome |
| Accession | NZ_LT549890 | ||
| Organism | Saccharolobus solfataricus strain P1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | SSOP1_RS07775 | Protein ID | WP_048054229.1 |
| Coordinates | 1432822..1433211 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A157T1M9 |
| Locus tag | SSOP1_RS07770 | Protein ID | WP_048054328.1 |
| Coordinates | 1432611..1432835 (+) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 1425258..1437993 | 12735 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14446.03 Da Isoelectric Point: 4.5625
>T293126 WP_048054229.1 NZ_LT549890:1432822-1433211 [Saccharolobus solfataricus]
MIVVDTNVLIYATLEDSEFHTQSLEIIEGSDIIVPQIVVFEYIKVLSEIVQNLDFIKTKISELNNFVVVCEDLNTIALAL
RLLAELKLSLKDINDMIILTAAIKTNSSIATFDQKLRKIADKKGVKVLP
MIVVDTNVLIYATLEDSEFHTQSLEIIEGSDIIVPQIVVFEYIKVLSEIVQNLDFIKTKISELNNFVVVCEDLNTIALAL
RLLAELKLSLKDINDMIILTAAIKTNSSIATFDQKLRKIADKKGVKVLP
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|